DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment dar1 and sptf-2

DIOPT Version :9

Sequence 1:	NP_001097493.1	Gene:	dar1 / 38436	FlyBaseID:	FBgn0263239	Length:	751	Species:	Drosophila melanogaster
Sequence 2:	NP_495833.1	Gene:	sptf-2 / 188733	WormBaseID:	WBGene00011926	Length:	166	Species:	Caenorhabditis elegans

Alignment Length:	135	Identity:	49/135 - (36%)
Similarity:	67/135 - (49%)	Gaps:	5/135 - (3%)

- Green bases have known domain annotations that are detailed below.

  Fly   609 PQQQPPPTPRSSGGGRRGRHSHHQPGTAAHIASLMSVRTVRYNRRNNPELEKRRIHHCDFVGCSK 673
            |...|..|..||.....|.:............:..:.:.:::..|.:     :..|.|...||.|
Worm    27 PPDSPASTSASSSSSSIGANELTTKRRKCERCTCPNCKAIKHGDRGS-----QHTHLCSVPGCGK 86

  Fly   674 VYTKSSHLKAHQRIHTGEKPYTCQWPECEWRFARSDELTRHYRKHTGAKPFKCIVCERSFARSDH 738
            .|.|:|||:||.|.|||::|:.|.|.:|..||.|||:|.||.|.||....|.|..|.|.|:||||
Worm    87 TYKKTSHLRAHLRKHTGDRPFVCDWFDCGKRFDRSDQLIRHKRTHTKEYRFACKFCIRQFSRSDH 151

  Fly   739 LALHM 743
            |..|:
Worm   152 LQQHL 156

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
dar1	NP_001097493.1	COG5048	641..>724	CDD:227381	32/82 (39%)
		C2H2 Zn finger	671..688	CDD:275368	10/16 (63%)
		zf-H2C2_2	680..707	CDD:290200	14/26 (54%)
		C2H2 Zn finger	696..718	CDD:275368	12/21 (57%)
		zf-H2C2_2	710..735	CDD:290200	11/24 (46%)
		C2H2 Zn finger	726..746	CDD:275368	10/18 (56%)
sptf-2	NP_495833.1	COG5048	<75..156	CDD:227381	41/80 (51%)
		C2H2 Zn finger	82..101	CDD:275368	11/18 (61%)
		C2H2 Zn finger	109..131	CDD:275368	12/21 (57%)
		C2H2 Zn finger	139..156	CDD:275368	9/16 (56%)

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	1	0.950	-	0	Normalized mean entropy	S1623
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	1	1.030	-	avgDist	Average_Evolutionary_Distance	R6780
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	1	1.000	-	-
TreeFam	0	0.000	Not matched by this tool.
	4	3.890