DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dar1 and Klf9

DIOPT Version :9

Sequence 1:NP_001097493.1 Gene:dar1 / 38436 FlyBaseID:FBgn0263239 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_034768.2 Gene:Klf9 / 16601 MGIID:1333856 Length:244 Species:Mus musculus


Alignment Length:258 Identity:83/258 - (32%)
Similarity:112/258 - (43%) Gaps:63/258 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   504 ISSSSASSASRHMFVP----------PLTPPSSDPGSPGSSMVAAAAAAAAQRRTTPPPPYQQGH 558
            :|.|:.::...|...|          .:|....|||............|.:........|.|...
Mouse    16 VSISNRAAVPEHGGAPEAERLRLPEREVTKEHGDPGDTWKDYCTLVTIAKSLLDLNKYRPIQTPS 80

  Fly   559 VM--GLINPPPTLQLLGGAATGSNNSCTTTLTTLTPASAIQQQQQQPQQQQVPQQQPPPTPRS-- 619
            |.  .|.:|...:        ||::..||        .:.......|:::|  .....|:|.|  
Mouse    81 VCSDSLESPDEDI--------GSDSDVTT--------ESGSSPSHSPEERQ--DSGSAPSPLSLL 127

  Fly   620 -SGGGRRGRHSHHQPGTAAHIASLMSVRTVRYNRRNNPELEKRRIHHCDFVGCSKVYTKSSHLKA 683
             ||...:|:|:.                            |||  |.|.:.||.|||.|||||||
Mouse   128 HSGVASKGKHAS----------------------------EKR--HKCPYSGCGKVYGKSSHLKA 162

  Fly   684 HQRIHTGEKPYTCQWPECEWRFARSDELTRHYRKHTGAKPFKCIVCERSFARSDHLALHMKRH 746
            |.|:||||:|:.|.||:|..:|:||||||||||.|||.|.|:|.:||:.|.|||||..|.:||
Mouse   163 HYRVHTGERPFPCTWPDCLKKFSRSDELTRHYRTHTGEKQFRCPLCEKRFMRSDHLTKHARRH 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dar1NP_001097493.1 COG5048 641..>724 CDD:227381 43/82 (52%)
C2H2 Zn finger 671..688 CDD:275368 13/16 (81%)
zf-H2C2_2 680..707 CDD:290200 16/26 (62%)
C2H2 Zn finger 696..718 CDD:275368 15/21 (71%)
zf-H2C2_2 710..735 CDD:290200 16/24 (67%)
C2H2 Zn finger 726..746 CDD:275368 10/19 (53%)
Klf9NP_034768.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 26..51 4/24 (17%)
COG5048 <78..234 CDD:227381 72/196 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 79..143 19/111 (17%)
C2H2 Zn finger 145..167 CDD:275368 15/21 (71%)
C2H2 Zn finger 175..197 CDD:275368 15/21 (71%)
C2H2 Zn finger 205..225 CDD:275368 10/19 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.