DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dar1 and klf2b

DIOPT Version :9

Sequence 1:NP_001097493.1 Gene:dar1 / 38436 FlyBaseID:FBgn0263239 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_571932.1 Gene:klf2b / 117509 ZFINID:ZDB-GENE-011109-2 Length:363 Species:Danio rerio


Alignment Length:376 Identity:114/376 - (30%)
Similarity:149/376 - (39%) Gaps:115/376 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   467 PTAQLGAQQQQQQ-------QQQQQLQQLCPP-----------------------------AAPS 495
            |:....|.|:::.       ::.:.|...|||                             |..:
Zfish     8 PSISTFANQKEKLWEDRWKIEEHKPLNASCPPLNVALNTDTCRGRKDDEDLSNYLDLEFILANTT 72

  Fly   496 TPSTSSSSISSSS--ASSASRHMFVPPLTPP---------SSDPGSPGSSMVAA---AAAAAAQR 546
            .|..:.:...|.|  ....|..::..|..||         .||..|...:.|..   ..::...|
Zfish    73 GPLEAGAEFISHSEPCGMYSTAVYSSPEAPPPYGLMAELLRSDVDSTYDTTVQGRFLLNSSGFPR 137

  Fly   547 RTTP-----PPPYQQGHVMGLINPPPTLQLLGGAATGSNNSCTTTLTTLTPASAIQQQQQQPQQQ 606
            :..|     ||....|.|:|::  |.|.|.:   ....|.||..:.             :||:..
Zfish   138 QEFPEIKVEPPMDGYGPVIGMV--PQTCQKI---KQEGNVSCMMSF-------------EQPRLA 184

  Fly   607 QVPQQQPPPTPRSSGGGRRGRHS------HHQPG---------TAAH------------------ 638
            ..||.....||..|......|.:      ||.|.         ||.|                  
Zfish   185 VSPQATGNMTPPLSPDDSHLRQTTYTQSYHHSPPAYPQVPMQFTAPHQFAMYEEAMGMQPSMQRA 249

  Fly   639 -------IASLMSVRTVRYNRRNNPELEKRRIHHCDFVGCSKVYTKSSHLKAHQRIHTGEKPYTC 696
                   ...||..:..| .||..|. ::...|.|.:.||.|.||||||||||.|.|||||||.|
Zfish   250 LLTPPSSPLELMESKPKR-GRRTWPR-KRMATHTCTYAGCGKTYTKSSHLKAHHRTHTGEKPYHC 312

  Fly   697 QWPECEWRFARSDELTRHYRKHTGAKPFKCIVCERSFARSDHLALHMKRHL 747
            .|..|.|:||||||||||:|||||.:||:|.:|||:|:|||||||||||||
Zfish   313 NWEGCGWKFARSDELTRHFRKHTGHRPFQCHLCERAFSRSDHLALHMKRHL 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dar1NP_001097493.1 COG5048 641..>724 CDD:227381 48/82 (59%)
C2H2 Zn finger 671..688 CDD:275368 13/16 (81%)
zf-H2C2_2 680..707 CDD:290200 18/26 (69%)
C2H2 Zn finger 696..718 CDD:275368 15/21 (71%)
zf-H2C2_2 710..735 CDD:290200 17/24 (71%)
C2H2 Zn finger 726..746 CDD:275368 15/19 (79%)
klf2bNP_571932.1 COG5048 <197..>362 CDD:227381 73/166 (44%)
zf-C2H2 280..304 CDD:278523 16/23 (70%)
C2H2 Zn finger 282..304 CDD:275368 15/21 (71%)
C2H2 Zn finger 312..334 CDD:275368 15/21 (71%)
zf-H2C2_2 326..351 CDD:290200 17/24 (71%)
C2H2 Zn finger 342..362 CDD:275368 15/19 (79%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23235
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.