DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dar1 and Klf3

DIOPT Version :9

Sequence 1:NP_001097493.1 Gene:dar1 / 38436 FlyBaseID:FBgn0263239 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_001099212.1 Gene:Klf3 / 114845 RGDID:1593290 Length:344 Species:Rattus norvegicus


Alignment Length:306 Identity:108/306 - (35%)
Similarity:143/306 - (46%) Gaps:83/306 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   490 PPAAPSTPSTSSSSISSSSASSASRHMFVPPLTPP--SSDPGSPG-------SSMVAAAAAAAAQ 545
            ||:|..:|    ||:...|...||..:.:|..:||  ...|.|||       .||....|||..:
  Rat    72 PPSAAGSP----SSLKFPSHRRASPGLSMPSSSPPIKKYSPPSPGVQPFGVPLSMPPVMAAALTR 132

  Fly   546 RRTTPPPPYQQGHVMGLINP---------------PPTLQLLGGAATGSNNSCTTTLTTLTPASA 595
            .....|      .::.:|.|               .|.:..|......||:.        .|...
  Rat   133 HGIRSP------GILPVIQPVVVQPVPFMYTSHLQQPLMVSLSEEMDNSNSG--------MPVPV 183

  Fly   596 IQQQQQQPQQQQV--------------PQQQPPPTPRSSGGGRRGRHSHH-----QPGTAAHIAS 641
            |:..::...|:::              |::..||...|....:.....:|     |||       
  Rat   184 IESYEKPILQKKIKIEPGIEPQRTDYYPEEMSPPLMNSVSPPQALLQENHPSVIVQPG------- 241

  Fly   642 LMSVRTVRYNRR----NNPELE-KRRIHHCDFVGCSKVYTKSSHLKAHQRIHTGEKPYTCQWPEC 701
                      :|    .:|:.: |||||.||:.||:||||||||||||:|.|||||||.|.|..|
  Rat   242 ----------KRPLPVESPDTQRKRRIHRCDYDGCNKVYTKSSHLKAHRRTHTGEKPYKCTWEGC 296

  Fly   702 EWRFARSDELTRHYRKHTGAKPFKCIVCERSFARSDHLALHMKRHL 747
            .|:||||||||||:|||||.|||:|..|:|||:||||||||.|||:
  Rat   297 TWKFARSDELTRHFRKHTGIKPFQCPDCDRSFSRSDHLALHRKRHM 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dar1NP_001097493.1 COG5048 641..>724 CDD:227381 51/87 (59%)
C2H2 Zn finger 671..688 CDD:275368 14/16 (88%)
zf-H2C2_2 680..707 CDD:290200 18/26 (69%)
C2H2 Zn finger 696..718 CDD:275368 15/21 (71%)
zf-H2C2_2 710..735 CDD:290200 18/24 (75%)
C2H2 Zn finger 726..746 CDD:275368 14/19 (74%)
Klf3NP_001099212.1 COG5048 <169..>331 CDD:227381 71/186 (38%)
zf-C2H2 259..283 CDD:278523 18/23 (78%)
C2H2 Zn finger 261..283 CDD:275368 17/21 (81%)
zf-H2C2_2 275..>292 CDD:290200 13/16 (81%)
C2H2 Zn finger 291..313 CDD:275368 15/21 (71%)
zf-H2C2_2 305..330 CDD:290200 18/24 (75%)
C2H2 Zn finger 321..341 CDD:275368 14/19 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23235
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.