DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dar1 and klf13

DIOPT Version :9

Sequence 1:NP_001097493.1 Gene:dar1 / 38436 FlyBaseID:FBgn0263239 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_001093690.1 Gene:klf13 / 100101699 XenbaseID:XB-GENE-479837 Length:258 Species:Xenopus tropicalis


Alignment Length:271 Identity:89/271 - (32%)
Similarity:111/271 - (40%) Gaps:79/271 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   492 AAPSTPSTSSSSI----------SSSSASSASRHMFVPPLTPPSSDPGSPGSSMVAAAAAAAAQR 546
            ||....|.||.:|          ..|..|||:     ||..||..|.....|..|.|...|...:
 Frog    11 AAECLVSMSSRAIVHTAPIGSPDGKSQGSSAA-----PPPAPPGEDRRENASLFVVARILADLNQ 70

  Fly   547 RTTPPPPYQQGHVMGLINPPPTLQLLGGAATGSNNSCTTTLTTLTPASAIQQQQQQP------QQ 605
            :...|                          |....|.   .:|.||.  .:..::|      .:
 Frog    71 QAPKP--------------------------GEKAECG---ISLLPAG--NEADREPPAGKRADR 104

  Fly   606 QQVPQQQPPPTPRSSGGGRRGRHSHHQPGTAAHIASLMSVRTVRYNRRNNPELEKRRIHHCDFVG 670
            ...|...|.|:|:..  .|||:                        .|.:||...:: |.|.:.|
 Frog   105 AATPPLLPEPSPKQR--ARRGK------------------------SRCDPESPLKK-HKCPYSG 142

  Fly   671 CSKVYTKSSHLKAHQRIHTGEKPYTCQWPECEWRFARSDELTRHYRKHTGAKPFKCIVCERSFAR 735
            |.|||.||||||||.|.||||:|:.|.|.||..:|||||||.||||.|||.|.|.|.:||:.|.|
 Frog   143 CEKVYGKSSHLKAHLRTHTGERPFECSWDECNKKFARSDELARHYRTHTGEKKFSCPICEKRFMR 207

  Fly   736 SDHLALHMKRH 746
            ||||..|.:||
 Frog   208 SDHLTKHARRH 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dar1NP_001097493.1 COG5048 641..>724 CDD:227381 43/82 (52%)
C2H2 Zn finger 671..688 CDD:275368 13/16 (81%)
zf-H2C2_2 680..707 CDD:290200 16/26 (62%)
C2H2 Zn finger 696..718 CDD:275368 15/21 (71%)
zf-H2C2_2 710..735 CDD:290200 15/24 (63%)
C2H2 Zn finger 726..746 CDD:275368 10/19 (53%)
klf13NP_001093690.1 COG5048 <131..230 CDD:227381 53/89 (60%)
C2H2 Zn finger 138..160 CDD:275368 15/21 (71%)
C2H2 Zn finger 168..190 CDD:275368 15/21 (71%)
C2H2 Zn finger 198..218 CDD:275368 10/19 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.