DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dar1 and klf5a

DIOPT Version :9

Sequence 1:NP_001097493.1 Gene:dar1 / 38436 FlyBaseID:FBgn0263239 Length:751 Species:Drosophila melanogaster
Sequence 2:XP_001344916.5 Gene:klf5a / 100006043 ZFINID:ZDB-GENE-090312-167 Length:429 Species:Danio rerio


Alignment Length:267 Identity:116/267 - (43%)
Similarity:139/267 - (52%) Gaps:71/267 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   481 QQQQLQQLCPPAAPSTPSTSSSSI-SSSSASSASRHMFVPPLTPPSSDPGSPGSSMVAAAAAAAA 544
            ||...:..|..||...|.:....: ....|.|..:..::|| :||:|:||||.            
Zfish   231 QQTAAKSYCGMAAHGYPLSHGHFVHPQDQAHSQLKMTYLPP-SPPTSEPGSPD------------ 282

  Fly   545 QRRTTPPPPYQQGHVMGLINPPPTLQLLGGAATGSNNSCTTTLTTLTPASAIQQQQQQPQQQQVP 609
                      :|..::..:.|||:.     |||.::.......:..|||||              
Zfish   283 ----------RQKELLHNLTPPPSY-----AATIASKMAGHAPSHPTPASA-------------- 318

  Fly   610 QQQPPPTPRSSGGGRRGRHSHHQPGTAAHIASLMSVRTVRYNRRNNPELEKRRIHHCDFVGCSKV 674
              :||.|..|                          ..||||||.||:|||||||||||.||.||
Zfish   319 --RPPTTTGS--------------------------MPVRYNRRTNPDLEKRRIHHCDFPGCKKV 355

  Fly   675 YTKSSHLKAHQRIHTGEKPYTCQWPECEWRFARSDELTRHYRKHTGAKPFKCIVCERSFARSDHL 739
            ||||||||||.|.|||||||.|.|..|:||||||||||||:|||||||||:|.||.|||:|||||
Zfish   356 YTKSSHLKAHLRTHTGEKPYRCTWEGCDWRFARSDELTRHFRKHTGAKPFQCAVCSRSFSRSDHL 420

  Fly   740 ALHMKRH 746
            |||||||
Zfish   421 ALHMKRH 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dar1NP_001097493.1 COG5048 641..>724 CDD:227381 63/82 (77%)
C2H2 Zn finger 671..688 CDD:275368 14/16 (88%)
zf-H2C2_2 680..707 CDD:290200 19/26 (73%)
C2H2 Zn finger 696..718 CDD:275368 16/21 (76%)
zf-H2C2_2 710..735 CDD:290200 20/24 (83%)
C2H2 Zn finger 726..746 CDD:275368 16/19 (84%)
klf5aXP_001344916.5 COG5048 322..>408 CDD:227381 67/111 (60%)
C2H2 Zn finger 350..369 CDD:275368 15/18 (83%)
zf-H2C2_2 361..>378 CDD:290200 13/16 (81%)
C2H2 Zn finger 377..399 CDD:275368 16/21 (76%)
zf-H2C2_2 391..416 CDD:290200 20/24 (83%)
C2H2 Zn finger 407..427 CDD:275368 16/19 (84%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 47 1.000 Domainoid score I12029
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006531
OrthoInspector 1 1.000 - - otm25419
orthoMCL 1 0.900 - - OOG6_107236
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6780
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
76.800

Return to query results.
Submit another query.