DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10357 and LIPG

DIOPT Version :9

Sequence 1:NP_647821.2 Gene:CG10357 / 38435 FlyBaseID:FBgn0035453 Length:321 Species:Drosophila melanogaster
Sequence 2:XP_005258447.1 Gene:LIPG / 9388 HGNCID:6623 Length:536 Species:Homo sapiens


Alignment Length:268 Identity:88/268 - (32%)
Similarity:132/268 - (49%) Gaps:23/268 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 IVHGYLGS-----CTHGSIMPLRNAYTAQGYENVLVADWGPVANLDYPSSRLAVKNVAQILAKLL 117
            |:||:..|     ..|..:..|   :|.:...||:|.||.|:|:..|..:....:.|...:|::|
Human   124 IIHGWTMSGIFENWLHKLVSAL---HTREKDANVVVVDWLPLAHQLYTDAVNNTRVVGHSIARML 185

  Fly   118 EEFLQRHGISLEGVHVIGHSLGAHIAGRIGRYFNGSLGRVTGLDPALPLFSSRS-DDSLHSNAAQ 181
            :...::...||..||:||:|||||:||..|.:..|::||:||||||.|:|.... ...|..:.|.
Human   186 DWLQEKDDFSLGNVHLIGYSLGAHVAGYAGNFVKGTVGRITGLDPAGPMFEGADIHKRLSPDDAD 250

  Fly   182 FVDVIHTDYPLFG---DIR-PRGTVDFYPNFGLAPQPGCENVDVVA--ASKLLHEAYSCSHNRAV 240
            ||||:||....||   .|: |.|.:|.|||.| ..||||...||:.  |...:.|...|.|.|||
Human   251 FVDVLHTYTRSFGLSIGIQMPVGHIDIYPNGG-DFQPGCGLNDVLGSIAYGTITEVVKCEHERAV 314

  Fly   241 MFYAESIGMPENFPAVSCSLTAIKSRRVEDCLREKSKTNTENANDYQTVFMGEHVNRSATLYYYL 305
            ..:.:|: :.::.|:.:...|  .|.|.:..:....:.|..|:..|....|....|..    .||
Human   315 HLFVDSL-VNQDKPSFAFQCT--DSNRFKKGICLSCRKNRCNSIGYNAKKMRNKRNSK----MYL 372

  Fly   306 ETNGAPPY 313
            :|....|:
Human   373 KTRAGMPF 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10357NP_647821.2 Pancreat_lipase_like 28..308 CDD:238363 86/261 (33%)
LIPGXP_005258447.1 Pancreat_lipase_like 85..376 CDD:238363 87/262 (33%)
lipo_lipase 86..521 CDD:132274 88/268 (33%)
PLAT_LPL 383..519 CDD:238856
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R8651
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.