DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10357 and Pla1a

DIOPT Version :9

Sequence 1:NP_647821.2 Gene:CG10357 / 38435 FlyBaseID:FBgn0035453 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_620237.1 Gene:Pla1a / 85311 RGDID:621261 Length:456 Species:Rattus norvegicus


Alignment Length:346 Identity:104/346 - (30%)
Similarity:143/346 - (41%) Gaps:108/346 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 DVSLENVEQLSSVESVKLIVHGYLGSCTHGS-----IMPLRNAYTAQGYENVLVADWGPVANLDY 99
            |..:.|.|..:|: ..|||:||:....|..|     |..|..|..|    ||:..||      .|
  Rat    70 DSDIRNSEFNASL-GTKLIIHGFRALGTKPSWINKFIRALLRAADA----NVIAVDW------VY 123

  Fly   100 PSSRL---AVKNVAQI-------LAKLLEEFLQRHGISLEGVHVIGHSLGAHIAGRIGRYFNGSL 154
            .|:.:   ||:||.::       |:||||     .|:|...:|:||.|||||:.|.:|.::.|.|
  Rat   124 GSTGMYFSAVENVVKLSLEISRFLSKLLE-----LGVSESSIHIIGVSLGAHVGGMVGHFYKGQL 183

  Fly   155 GRVTGLDPALPLFSSRS-DDSLHSNAAQFVDVIHTDYPLFGDIRPRGTVDFYPNFGLAPQPGCEN 218
            ||:||||||.|.::..| ::.|.|..|.||:.||||....|...|.|.||::.|.| ..||||  
  Rat   184 GRITGLDPAGPEYTRASLEERLDSGDALFVEAIHTDTDNLGIRIPVGHVDYFVNGG-QDQPGC-- 245

  Fly   219 VDVVAASKLLHEAYS---CSHNRAVMFYAESIGMPEN------FPA------------------- 255
                  ...:|..||   |.|.|||..|..::   ||      ||.                   
  Rat   246 ------PAFIHAGYSYLICDHMRAVHLYISAL---ENTCPLMAFPCASYKAFLAGDCLDCFNPFL 301

  Fly   256 VSCSLTAIKSR-----------------------------RVEDCLREKSKTNTENANDYQTVFM 291
            :||....:..|                             .||..|:||.|.:|    ..:..|:
  Rat   302 LSCPRIGLVERGGVKIEPLPKEVRVYLQTTSSAPYCVHHSLVEFNLKEKRKKDT----SIEVTFL 362

  Fly   292 GEHVNRSATLYY---YLETNG 309
            |.:|..|..:..   :||..|
  Rat   363 GNNVTSSVKITIPKDHLEGRG 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10357NP_647821.2 Pancreat_lipase_like 28..308 CDD:238363 103/343 (30%)
Pla1aNP_620237.1 Lipase 14..336 CDD:278576 90/293 (31%)
Pancreat_lipase_like 49..332 CDD:238363 90/289 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.