DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10357 and Pla1a

DIOPT Version :9

Sequence 1:NP_647821.2 Gene:CG10357 / 38435 FlyBaseID:FBgn0035453 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_598863.3 Gene:Pla1a / 85031 MGIID:1934677 Length:456 Species:Mus musculus


Alignment Length:261 Identity:87/261 - (33%)
Similarity:122/261 - (46%) Gaps:52/261 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 PSADVSLENVEQLSSVE-----SVKLIVHGYLGSCTHGS-IMPLRNAYTAQGYENVLVADWGPVA 95
            ||....:|....:.|.|     ..|:|:||:....|..| |....:|.......||:..||    
Mouse    61 PSCGQLVEEGSDIRSSEFNASLGTKVIIHGFRALGTKPSWIDKFISAVLRAADANVIAVDW---- 121

  Fly    96 NLDYPSSRL---AVKNVAQI-------LAKLLEEFLQRHGISLEGVHVIGHSLGAHIAGRIGRYF 150
              .|.|:.:   ||:||.::       |:||||     .|:|...:|:||.|||||:.|.:|.::
Mouse   122 --VYGSTGVYYSAVENVVKLSLEISRFLSKLLE-----LGVSESSIHIIGVSLGAHVGGMVGHFY 179

  Fly   151 NGSLGRVTGLDPALPLFSSRS-DDSLHSNAAQFVDVIHTDYPLFGDIRPRGTVDFYPNFGLAPQP 214
            .|.||::||||||.|.::..| ::.|.:..|.||:.||||....|...|.|.||::.|.| ..||
Mouse   180 KGQLGQITGLDPAGPEYTRASLEERLDAGDALFVEAIHTDTDNLGIRIPVGHVDYFVNGG-QDQP 243

  Fly   215 GCENVDVVAASKLLHEAYS---CSHNRAVMFYAESIGMPENFPAVSCSLTAI-----KSRRVEDC 271
            ||        ....|..|:   |.|.|||..|..::   ||    :|.|.|.     |:....||
Mouse   244 GC--------PAFFHAGYNYLICDHMRAVHLYISAL---EN----TCPLMAFPCASYKAFLAGDC 293

  Fly   272 L 272
            |
Mouse   294 L 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10357NP_647821.2 Pancreat_lipase_like 28..308 CDD:238363 87/261 (33%)
Pla1aNP_598863.3 Lipase 14..336 CDD:333880 87/261 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.