DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10357 and Pnliprp1

DIOPT Version :9

Sequence 1:NP_647821.2 Gene:CG10357 / 38435 FlyBaseID:FBgn0035453 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_114470.1 Gene:Pnliprp1 / 84028 RGDID:620792 Length:473 Species:Rattus norvegicus


Alignment Length:321 Identity:88/321 - (27%)
Similarity:144/321 - (44%) Gaps:45/321 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LNQSTIYYL--KPSADVSLENVEQLS-------SVESVKLIVHGYLGSCTHGSIMPL-RNAYTAQ 81
            :|...:.|.  .|:|..:|:..:.|:       .....:.|:||::.......::.: :|.:..:
  Rat    52 INTRFLLYTNENPTAFQTLQLSDPLTIGASNFQVARKTRFIIHGFIDKGEENWVVDMCKNMFQVE 116

  Fly    82 GYENVLVADWGPVANLDYPSSRLAVKNVAQILAKLLEEFLQRHGISLEGVHVIGHSLGAHIAGRI 146
            .. |.:..||...:...|..:...|:.|...:|::::..::.:..|...||:||||||||:||..
  Rat   117 EV-NCICVDWKKGSQTTYTQAANNVRVVGAQVAQMIDILVKNYSYSPSKVHLIGHSLGAHVAGEA 180

  Fly   147 GRYFNGSLGRVTGLDPALPLFSSRSDD-SLHSNAAQFVDVIHTD-YPL-----FGDIRPRGTVDF 204
            |....| |||:|||||....|....:: .|..:.|.|||||||| .||     ||..:..|.:||
  Rat   181 GSRTPG-LGRITGLDPVEANFEGTPEEVRLDPSDADFVDVIHTDAAPLIPFLGFGTNQMSGHLDF 244

  Fly   205 YPNFGLAPQPGCEN------VDVVAASKLLHEAYSCSHNRAVMFYAESIGMPENFPAVSC-SLTA 262
            :||.|.: .|||:.      ||:........:..:|:|.|:..:|.|||..|:.|.|..| |...
  Rat   245 FPNGGQS-MPGCKKNALSQIVDIDGIWSGTRDFVACNHLRSYKYYLESILNPDGFAAYPCASYKD 308

  Fly   263 IKSRRVEDCLREKSKTNTENANDYQTVFMGEHVNRSA------TLYYYLETNGAPPYGQGR 317
            .:|.:...|            .|.....||.:.::.|      ...::|.|..|..:.:.|
  Rat   309 FESNKCFPC------------PDQGCPQMGHYADKFAGKSGDEPQKFFLNTGEAKNFARWR 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10357NP_647821.2 Pancreat_lipase_like 28..308 CDD:238363 85/309 (28%)
Pnliprp1NP_114470.1 Lipase 18..353 CDD:395099 87/315 (28%)
PLAT_PL 356..467 CDD:238857 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.