DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10357 and Liph

DIOPT Version :9

Sequence 1:NP_647821.2 Gene:CG10357 / 38435 FlyBaseID:FBgn0035453 Length:321 Species:Drosophila melanogaster
Sequence 2:XP_038944552.1 Gene:Liph / 681694 RGDID:1592849 Length:476 Species:Rattus norvegicus


Alignment Length:323 Identity:104/323 - (32%)
Similarity:157/323 - (48%) Gaps:55/323 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LCLV--------PILCQFLGLHAALLDSLLN-QSTIYYLKPSADVSLENVEQLSSVESVK---LI 58
            :|||        |...: |..|:|::.:.|: :..:|..:......:.|...|.|:...|   .|
  Rat    48 MCLVKSDTDETCPSFTR-LSFHSAVVGTGLSVRLMLYTQRDQTCAQVINSTALGSLNVTKKTTFI 111

  Fly    59 VHGYLGSCTHGS----IMPLRNAYTAQGYENVLVADWGPVA-NLDYPSSRLAVKNVAQILAKLLE 118
            :||:..:   ||    :..|..:..:....||:|.||...| .:.||.:....:.||.||.:.::
  Rat   112 IHGFRPT---GSPPVWMEELVQSLISVQEMNVVVVDWNRGATTVIYPHASSKTRKVALILKEFID 173

  Fly   119 EFLQRHGISLEGVHVIGHSLGAHIAGRIGRYFNGSLGRVTGLDPALPLFSSR-SDDSLHSNAAQF 182
            :.|.: |.||:.:::||.||||||||.:|..::|.|||:||||||.|||:.| .:|.|..:.|||
  Rat   174 QMLAK-GASLDNIYMIGVSLGAHIAGFVGEMYSGKLGRITGLDPAGPLFNGRPPEDRLDPSDAQF 237

  Fly   183 VDVIHTDYPLFGDIRPRGTVDFYPNFGLAPQPGCENVDVVAASKLLHEAYSCSHNRAVMFYAESI 247
            |||||:|....|.....|.:|||||.|| .||||... :....|.    :.|.|..:|..|..|:
  Rat   238 VDVIHSDTDALGYREALGHIDFYPNGGL-DQPGCPKT-IFGGIKY----FKCDHQMSVFLYLASL 296

  Fly   248 GMPENFPAVSCSLTAIKSRRVEDCLREKSKTNTENANDYQT---VFMGE-HVNRSATLYYYLE 306
               :|    :||:||.      .|         ::..||:.   |..|. |:....:|.||.:
  Rat   297 ---QN----NCSITAY------PC---------DSYRDYRNGKCVSCGAGHIVSCPSLGYYAD 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10357NP_647821.2 Pancreat_lipase_like 28..308 CDD:238363 96/293 (33%)
LiphXP_038944552.1 Pancreat_lipase_like 78..347 CDD:238363 96/292 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.