DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10357 and PNLIPRP1

DIOPT Version :9

Sequence 1:NP_647821.2 Gene:CG10357 / 38435 FlyBaseID:FBgn0035453 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001290064.1 Gene:PNLIPRP1 / 5407 HGNCID:9156 Length:467 Species:Homo sapiens


Alignment Length:309 Identity:87/309 - (28%)
Similarity:131/309 - (42%) Gaps:35/309 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 NQSTIYYLKPSADVSLENVEQLSSVESVKLIVHGYLGSCTHGSIMPLRNAYTAQGYENVLVADWG 92
            |...|..|...:.:...|.:.   ....:.|:||::.......:..:..........|.:..||.
Human    65 NNFQILLLSDPSTIEASNFQM---DRKTRFIIHGFIDKGDESWVTDMCKKLFEVEEVNCICVDWK 126

  Fly    93 PVANLDYPSSRLAVKNVAQILAKLLEEFLQRHGISLEGVHVIGHSLGAHIAGRIGRYFNGSLGRV 157
            ..:...|..:...|:.|...:|::|:..|..:......||:||||||||:||..|....| |.|:
Human   127 KGSQATYTQAANNVRVVGAQVAQMLDILLTEYSYPPSKVHLIGHSLGAHVAGEAGSKTPG-LSRI 190

  Fly   158 TGLDPALPLFSSRSDD-SLHSNAAQFVDVIHTD-YPL-----FGDIRPRGTVDFYPNFGLAPQPG 215
            |||||....|.|..:: .|..:.|.|||||||| .||     ||..:..|.:||:||.| ...||
Human   191 TGLDPVEASFESTPEEVRLDPSDADFVDVIHTDAAPLIPFLGFGTNQQMGHLDFFPNGG-ESMPG 254

  Fly   216 CEN------VDVVAASKLLHEAYSCSHNRAVMFYAESIGMPENFPAVSCSLTAIKSRRVEDCLRE 274
            |:.      ||:........:..:|:|.|:..:|.|||..|:.|.|..|  |:.||...:.|.  
Human   255 CKKNALSQIVDLDGIWAGTRDFVACNHLRSYKYYLESILNPDGFAAYPC--TSYKSFESDKCF-- 315

  Fly   275 KSKTNTENANDYQTVFMGEHVNRSA------TLYYYLETNGAPPYGQGR 317
                   ...|.....||.:.::.|      ...::|.|..|..:.:.|
Human   316 -------PCPDQGCPQMGHYADKFAGRTSEEQQKFFLNTGEASNFARWR 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10357NP_647821.2 Pancreat_lipase_like 28..308 CDD:238363 84/298 (28%)
PNLIPRP1NP_001290064.1 Lipase 18..353 CDD:278576 86/303 (28%)
Pancreat_lipase_like 52..349 CDD:238363 85/299 (28%)
PLAT_PL 356..467 CDD:238857 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.