DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10357 and CG6283

DIOPT Version :9

Sequence 1:NP_647821.2 Gene:CG10357 / 38435 FlyBaseID:FBgn0035453 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_651524.1 Gene:CG6283 / 43250 FlyBaseID:FBgn0039474 Length:339 Species:Drosophila melanogaster


Alignment Length:297 Identity:88/297 - (29%)
Similarity:140/297 - (47%) Gaps:44/297 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 YLKPSADVSLENVEQLSSVE--------SVKLIVHGYLGSCTHGSIMPLRNAYTAQGYENVLVAD 90
            |.|.:.....|...:..|||        ..:.::||:....:......:..|:.::|..||:|.|
  Fly    70 YTKSNPTDGKEIKAKSGSVEDSHFNKDHGTRFVIHGWTQRYSDDMNTRITKAWLSKGDYNVIVVD 134

  Fly    91 WGPVANLDYPSSRLAVKNVAQILAKLLEEFLQRHGISLEGVHVIGHSLGAHIAGRIGRYFNGS-L 154
            |....::||.||.|||......:.::::.....||:..:.:.|||||||||:||..|:..... :
  Fly   135 WARARSVDYASSVLAVPGAGGKVGEMIKYLHDHHGLDYDSLEVIGHSLGAHVAGYAGKTVGDKRV 199

  Fly   155 GRVTGLDPALPLFS-SRSDDSLHSNAAQFVDVIHTDYPLFGDIRPRGTVDFYPNFGLAPQPGCEN 218
            ..:.|||||||||| .:....|.::.|.:|:.|.|:....|.::|.|...||||.|.: |||| .
  Fly   200 HTIVGLDPALPLFSYDKPAKRLSTDDAHYVESIQTNGGKLGFLKPIGKGAFYPNGGKS-QPGC-G 262

  Fly   219 VDVVAASKLLHEAYSCSHNRAVMFYAESIGMPENFPAVSCSLTAIKSRRVEDCLREKSKTNTENA 283
            :|...         ||||.|:|::|||:: ..:||.::.|       ...||.:.:..      .
  Fly   263 LDATG---------SCSHARSVLYYAEAV-TEDNFGSIKC-------HDYEDAVAKNC------G 304

  Fly   284 NDYQTVFMGEHVNRSATLY-----YYLETNGAPPYGQ 315
            :.|.:|.||...|    .|     :|:..|...|:|:
  Fly   305 STYSSVRMGAITN----AYMVEGDFYVPVNSEAPFGK 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10357NP_647821.2 Pancreat_lipase_like 28..308 CDD:238363 85/288 (30%)
CG6283NP_651524.1 Pancreat_lipase_like 65..331 CDD:238363 85/289 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.