DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10357 and sxe2

DIOPT Version :9

Sequence 1:NP_647821.2 Gene:CG10357 / 38435 FlyBaseID:FBgn0035453 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001287352.1 Gene:sxe2 / 41954 FlyBaseID:FBgn0038398 Length:387 Species:Drosophila melanogaster


Alignment Length:297 Identity:88/297 - (29%)
Similarity:139/297 - (46%) Gaps:23/297 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LNQSTIYYLKPSADVSLENVEQLSSVESVKLIVHGYLGSCTHGSIMPLRNAYTAQGYENVLVADW 91
            ||......|:| .|:::......:....|::.:||:.|.....|...:::||.::|..||::.||
  Fly    79 LNPEERQLLRP-GDLTMLRNSHFNPKWPVRVSIHGWAGKSVTCSNAAIKDAYLSRGNYNVIILDW 142

  Fly    92 GPVA-NLDYPSSRLAVKNVAQILAKLLEEFLQRHGISLEGVHVIGHSLGAHIAGRIGRYFN-GSL 154
            ...: ::.||.....:.::|..:||:|.......|:..|.:::||||.|:||:|..|:... ..|
  Fly   143 SRQSLDISYPRVSKQLPSIAANVAKMLRFLHDNTGVPYEQIYMIGHSAGSHISGLTGKLLRPHRL 207

  Fly   155 GRVTGLDPA-LPLFSSRSDDSLHSNAAQFVDVIHTDYPLFGDIRPR-GTVDFYPNFGLAPQPGCE 217
            |.:..|||| |...|...::.|..|.|.:|:.||||..|.|:...: ....|:.|:||. ||.|.
  Fly   208 GAIFALDPAGLTQLSLGPEERLDVNDALYVESIHTDLTLLGNPSTKLSHASFFANWGLG-QPHCP 271

  Fly   218 NVDVVAASKLLHEAYSCSHNRAVMFYAESIGMPENFPAVSCSLTAIKSRRVEDCL-----REKSK 277
            |.......      :.|.|..|:.::|||:..|::|.|:.||  :.||.....|.     .||..
  Fly   272 NATATEFD------FVCDHFAAMFYFAESVRQPKSFAALRCS--SAKSVLSATCNCNVGGSEKYA 328

  Fly   278 TNTENANDYQTVFMGEHVNRSATLYYYLETNGAPPYG 314
            .||...|:    |||..........:||.|....|||
  Fly   329 VNTCTGNE----FMGGEPAVPKRGIFYLSTRPQSPYG 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10357NP_647821.2 Pancreat_lipase_like 28..308 CDD:238363 83/288 (29%)
sxe2NP_001287352.1 Lipase 53..360 CDD:278576 85/294 (29%)
Pancreat_lipase_like 72..356 CDD:238363 85/290 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.