DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10357 and LPL

DIOPT Version :9

Sequence 1:NP_647821.2 Gene:CG10357 / 38435 FlyBaseID:FBgn0035453 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_000228.1 Gene:LPL / 4023 HGNCID:6677 Length:475 Species:Homo sapiens


Alignment Length:277 Identity:89/277 - (32%)
Similarity:132/277 - (47%) Gaps:35/277 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 LIVHGYLGSCTHGSIMP--LRNAYTAQGYENVLVADWGPVANLDYPSSRLAVKNVAQILAKLLEE 119
            :::||:..:..:.|.:|  :...|..:...||:|.||...|...||.|....|.|.|.:|:.:..
Human    77 MVIHGWTVTGMYESWVPKLVAALYKREPDSNVIVVDWLSRAQEHYPVSAGYTKLVGQDVARFINW 141

  Fly   120 FLQRHGISLEGVHVIGHSLGAHIAGRIGRYFNGSLGRVTGLDPALPLFS-SRSDDSLHSNAAQFV 183
            ..:.....|:.||::|:|||||.||..|...|..:.|:||||||.|.|. :.:...|..:.|.||
Human   142 MEEEFNYPLDNVHLLGYSLGAHAAGIAGSLTNKKVNRITGLDPAGPNFEYAEAPSRLSPDDADFV 206

  Fly   184 DVIHT---DYP--LFGDIRPRGTVDFYPNFGLAPQPGC---ENVDVVAASKL--LHEAYSCSHNR 238
            ||:||   ..|  ..|..:|.|.||.|||.|.. ||||   |.:.|:|...|  :.:...|||.|
Human   207 DVLHTFTRGSPGRSIGIQKPVGHVDIYPNGGTF-QPGCNIGEAIRVIAERGLGDVDQLVKCSHER 270

  Fly   239 AVMFYAESIGMPEN-FPAVSCSLTAIKSRRVEDCLR-EKSKTNTENANDYQTVFMGEHVN----- 296
            ::..:.:|:...|| ..|..||......:.:  ||. .|::.|.          :|..:|     
Human   271 SIHLFIDSLLNEENPSKAYRCSSKEAFEKGL--CLSCRKNRCNN----------LGYEINKVRAK 323

  Fly   297 RSATLYYYLETNGAPPY 313
            ||:.:  ||:|....||
Human   324 RSSKM--YLKTRSQMPY 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10357NP_647821.2 Pancreat_lipase_like 28..308 CDD:238363 86/270 (32%)
LPLNP_000228.1 Interaction with GPIHBP1. /evidence=ECO:0000269|PubMed:30559189 32..53
Lipase 33..473 CDD:332983 89/277 (32%)
Essential for determining substrate specificity. /evidence=ECO:0000269|PubMed:7592706 243..266 5/22 (23%)
Important for interaction with lipoprotein particles. /evidence=ECO:0000269|PubMed:27929370 417..421
Important for heparin binding. /evidence=ECO:0000269|PubMed:11342582 430..434
Interaction with GPIHBP1. /evidence=ECO:0000269|PubMed:26725083, ECO:0000269|PubMed:30559189 443..467
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.