DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10357 and LIPC

DIOPT Version :10

Sequence 1:NP_647821.2 Gene:CG10357 / 38435 FlyBaseID:FBgn0035453 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_000227.2 Gene:LIPC / 3990 HGNCID:6619 Length:499 Species:Homo sapiens


Alignment Length:167 Identity:34/167 - (20%)
Similarity:61/167 - (36%) Gaps:54/167 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 LAASLSLAAARRIVEADEFMRGGLYEGWLPHLFVGNLLKGQTVGVIGAGRIGSAYARMMVEGFKM 190
            |.||.|:|....:..:  |::..|.:|.|                :..|...|::.||:...|..
Human   116 LNASASVALKEVVFYS--FLKPWLGDGLL----------------LSDGDKWSSHRRMLTPAFHF 162

  Fly   191 NLI--YFDLY-QSTRLEKFVTAYGQFLKANGEQPVTWKRASSMEEVLREADLISLHPVLDKTTYH 252
            |::  |..:: .||.:   :.|..|.|.:.|         |:..:|.....|::|.. |.|..:.
Human   163 NILKPYVKIFNDSTNI---MHAKWQHLASGG---------SARLDVFENISLMTLDS-LQKCVFS 214

  Fly   253 LVNKERLAMMKKEAILVNCSRGP------VIDEAALV 283
            ..:              ||...|      :::.:|||
Human   215 FDS--------------NCQENPSEYISAILELSALV 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10357NP_647821.2 Pancreat_lipase_like 28..308 CDD:238363 34/167 (20%)
LIPCNP_000227.2 Lipase 24..349 CDD:395099 34/167 (20%)
Essential for determining substrate specificity. /evidence=ECO:0000269|PubMed:7592706 254..277
PLAT_LPL 352..487 CDD:238856
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.