DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10357 and lipca

DIOPT Version :9

Sequence 1:NP_647821.2 Gene:CG10357 / 38435 FlyBaseID:FBgn0035453 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_957316.1 Gene:lipca / 393997 ZFINID:ZDB-GENE-040426-1361 Length:514 Species:Danio rerio


Alignment Length:287 Identity:99/287 - (34%)
Similarity:144/287 - (50%) Gaps:50/287 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 LIVHGY-LGSCTHGSIMPLRNAY-TAQGYENVLVADWGPVANLDYP----SSRLAVKNVAQILAK 115
            :|:||: :.......|..|.:|. :::|..|||:|||..:|:..||    ::|:..:::|.:|: 
Zfish    82 IIIHGWSVDGMMEKWISRLASALKSSEGNINVLIADWLTLAHQHYPIAAQNTRIVGQDIAHLLS- 145

  Fly   116 LLEEFLQRHGISLEGVHVIGHSLGAHIAGRIGRYFNGS--------LGRVTGLDPALPLFSSRS- 171
            .||:|.|   ..|..||:||:||||||:|     |.||        |||:||||||.|:|...| 
Zfish   146 WLEDFKQ---FPLGKVHLIGYSLGAHISG-----FAGSNLAMSGRTLGRITGLDPAGPMFEGMSH 202

  Fly   172 DDSLHSNAAQFVDVIHTDYPL------FGDIRPRGTVDFYPNFGLAPQPGCE-NVDVVAASKLLH 229
            .|.|....|:|||.||| :.|      .|..:|....|||||.| :.||||: ::..:.|....|
Zfish   203 TDRLSPEDAKFVDAIHT-FTLQRMGLSVGIKQPVAHFDFYPNGG-SFQPGCQLHMQNIYAHLAQH 265

  Fly   230 ------EAYSCSHNRAVMFYAES-IGMPENFPAVSCS-LTAIKSRRVEDCLREKSKTNTENANDY 286
                  :...|:|.|||..:.:| :...:...|..|| .||.......||  .|::.|| ...|.
Zfish   266 GIMGFEQTVKCAHERAVHLFIDSLLNKDKQIMAYKCSDNTAFDKGNCLDC--RKNRCNT-LGYDI 327

  Fly   287 QTVFMGEHVNRSATLYYYLETNGAPPY 313
            :.|..|    :|..|  :|:|....||
Zfish   328 KKVRTG----KSKRL--FLKTRSHMPY 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10357NP_647821.2 Pancreat_lipase_like 28..308 CDD:238363 96/280 (34%)
lipcaNP_957316.1 lipo_lipase 44..488 CDD:132274 99/287 (34%)
Pancreat_lipase_like 54..344 CDD:238363 97/281 (35%)
PLAT_LPL 351..485 CDD:238856
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.