DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10357 and CG13562

DIOPT Version :9

Sequence 1:NP_647821.2 Gene:CG10357 / 38435 FlyBaseID:FBgn0035453 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001246484.1 Gene:CG13562 / 37797 FlyBaseID:FBgn0034928 Length:342 Species:Drosophila melanogaster


Alignment Length:337 Identity:74/337 - (21%)
Similarity:120/337 - (35%) Gaps:75/337 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 ILCQFLGLHAALLDSLLNQSTIYY--------------LKPSADVSLENVEQLSS-----VESVK 56
            ||.|.....|...|:|.:|..|.|              .|.....:.::...||.     .:...
  Fly    32 ILRQKQAAKATQNDTLAHQQRIKYDAQKTMKVMFYKNNTKTMETSAYDDAYDLSGSGCSPTDKFA 96

  Fly    57 LIVHGYLGSCTHGSIMPL--RNAYTAQGYENVLVADWGPVANLDYPSSRLAVK------NVAQIL 113
            :::||::.||:....:.|  |.:|...|.  |:..|:..||:..|  .||...      .::.|:
  Fly    97 IVLHGWIQSCSDEWALSLIERLSYYRGGC--VICIDYSVVASSSY--MRLYTNFDTLTGAISSII 157

  Fly   114 AKLLEEFLQRHGISLEGVHVIGHSLGAHIAGRIGRYF--NGSLGRVTGLDPALPLFSSRSDDSLH 176
            ..|.     |.|...:..::.|.|.|..:|..:||..  :..:..:...|.|.|.|...:.|  |
  Fly   158 LTLF-----RQGFDPKRGYMFGFSFGGQLASAVGRSLRPHHIIESIDTCDMAGPGFDPIAVD--H 215

  Fly   177 SNAAQFVDVIHTDYPLFGDIRPRGTVDF--YPNFGLAPQPGCENVDVVAASKLLHEAYSCSHNRA 239
            |.|.:.|...|:.       |.:||..:  :.|..|.   .|.......||:|    :..||...
  Fly   216 SKAGKHVQCFHSS-------RDKGTFVYSCHRNIMLG---SCGLKQPSVASQL----HLGSHGLC 266

  Fly   240 VMFYAESIGMP---ENFPAVSCSLTAIKSRRVEDCLREKSKTNTENANDYQTVFMGEHVNRSATL 301
            |..|..:...|   .|:....| .|..|:.::.|              .| ||...|:.:...|.
  Fly   267 VDIYINTFDYPFYAVNYTPPEC-FTWQKTAKIPD--------------GY-TVGYEENFDSQVTG 315

  Fly   302 YYYLETNGAPPY 313
            ..::.|:...||
  Fly   316 QIFVPTSLHYPY 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10357NP_647821.2 Pancreat_lipase_like 28..308 CDD:238363 65/313 (21%)
CG13562NP_001246484.1 Abhydrolase 64..>208 CDD:304388 31/152 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.