DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10357 and CG6472

DIOPT Version :9

Sequence 1:NP_647821.2 Gene:CG10357 / 38435 FlyBaseID:FBgn0035453 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_611166.2 Gene:CG6472 / 36895 FlyBaseID:FBgn0034166 Length:389 Species:Drosophila melanogaster


Alignment Length:305 Identity:106/305 - (34%)
Similarity:144/305 - (47%) Gaps:47/305 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 DSLLNQSTIYYLKPSADVSLENVEQLSSVESVKLIVHGYLGSCT--HGSIMPLRNAYTAQGYENV 86
            |:.|.||...:..|.|                 :.:||:..|.|  ..|...|::|:..:|..||
  Fly    65 DARLAQSNFNFNYPLA-----------------IYLHGFSESATGERQSSQELKDAFLRRGNYNV 112

  Fly    87 LVADWGPVANLDYPSSRLAVKNV---AQILAKLLEEFLQRHGISLEGVHVIGHSLGAHIAGRIGR 148
            ::.||..:..:.:.|:  ||:|:   .:.||:.| .||...|...:.:|:||.||||.:||..|:
  Fly   113 ILIDWSAMTAVPWYSN--AVENLPVSGRYLARFL-RFLVDKGYPAKYIHLIGFSLGAEVAGFAGK 174

  Fly   149 YFNG---SLGRVTGLDPALPLFSSRSDD-SLHSNAAQFVDVIHTDYPLFGDIRPRGTVDFYPNFG 209
            ....   .|.|:|.||||||||...|.: .|..:.|:||||||||..|.|:..|.|..|||||.|
  Fly   175 QLQEWGIKLPRITALDPALPLFEGNSSNRRLSPSDARFVDVIHTDGGLLGNPAPMGHADFYPNGG 239

  Fly   210 LAPQPGCENVDVVAASKLLHEAYSCSHNRAVMFYAESIGMPENFPAVSCSLTAIKSRRVEDCLRE 274
            ...||||...::  |:..|.....|||.||..::.|||..|..|||..|.    .|.....| ||
  Fly   240 RPLQPGCAKQNI--ANNWLGIIVGCSHQRAWEYFVESIAQPRGFPAQRCE----PSDMFGIC-RE 297

  Fly   275 KSKTNTENANDYQTVFMGEHVNRSATLYYYLETNGAPPYGQGRNS 319
            ...         ...|||...:......:||:||.|.|:  ||||
  Fly   298 PGG---------GPAFMGMGADPRIRGKFYLDTNDAKPF--GRNS 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10357NP_647821.2 Pancreat_lipase_like 28..308 CDD:238363 96/288 (33%)
CG6472NP_611166.2 Pancreat_lipase_like 43..323 CDD:238363 99/293 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.