DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10357 and CG13282

DIOPT Version :9

Sequence 1:NP_647821.2 Gene:CG10357 / 38435 FlyBaseID:FBgn0035453 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001260521.1 Gene:CG13282 / 35019 FlyBaseID:FBgn0032612 Length:484 Species:Drosophila melanogaster


Alignment Length:291 Identity:86/291 - (29%)
Similarity:135/291 - (46%) Gaps:49/291 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 ENVEQLSSVES-------VKLIVHGYLGSCTHGSIMPLRNAYTAQGYENVLVADW-----GPVAN 96
            |::|:.:..:|       .|:|:|||........:..:|..|.|:...|::..||     ||.  
  Fly    97 ESLEKSNLTDSYFNPRYPTKIIIHGYNSDMFLHPLQQMREEYLAKADYNIIYVDWSILSPGPC-- 159

  Fly    97 LDYPSSRLAVKNVAQILAKLLEEFLQRHGISLEGVHVIGHSLGAHIAGRIGRYFNG-SLGRVTGL 160
              |.|:....|:.....|:|:|..::.....   :||||.||||.:...|.|..:. .|.|:|||
  Fly   160 --YISAVHNTKHAGTCTAQLVERLVETGNTD---IHVIGFSLGAQVPNYIARNLSSFMLPRITGL 219

  Fly   161 DPALPLF-SSRSDDSLHSNAAQFVDVIHTDYPLFGDIRPRGTVDFYPNFGLAPQPGCENVDVVAA 224
            |||:||| :|...|.|..:.|.:||||||:..:.|.:...|..|||.|.|:. ||||....:   
  Fly   220 DPAMPLFITSGKADKLDPSDASYVDVIHTNALVQGKMERCGHADFYMNGGIM-QPGCNGQKI--- 280

  Fly   225 SKLLHEAYSCSHNRAVMFYAESIGMPENFPAVSCSLTAIKSRRVEDCLREKSKTNTENANDYQTV 289
                 .:::|||.||..::.|||..|:.|...:|      |..:...|.....||          
  Fly   281 -----NSFACSHQRAPAYFLESIRSPKGFWGWAC------SGYISYLLGMCPPTN---------- 324

  Fly   290 FM---GEHVNRSATLYYYLETNGAPPYGQGR 317
            |:   ||::..:....:.::||.:.|:..|:
  Fly   325 FLLEAGENIRPTTRGMFMIDTNDSSPFALGK 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10357NP_647821.2 Pancreat_lipase_like 28..308 CDD:238363 82/280 (29%)
CG13282NP_001260521.1 Lipase 67..351 CDD:278576 84/285 (29%)
Pancreat_lipase_like 75..347 CDD:238363 83/281 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.