DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10357 and CG17292

DIOPT Version :9

Sequence 1:NP_647821.2 Gene:CG10357 / 38435 FlyBaseID:FBgn0035453 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001285749.1 Gene:CG17292 / 34152 FlyBaseID:FBgn0032029 Length:340 Species:Drosophila melanogaster


Alignment Length:327 Identity:102/327 - (31%)
Similarity:158/327 - (48%) Gaps:45/327 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 ILCQFLGLHAALLDSLLNQSTIYYLKPSAD---------VSLENVEQLSSVESVKLIVHGYLGSC 66
            :||   ||..:..|....:..:||....||         .||...|.|...::..|.:||||...
  Fly    11 LLC---GLKNSKADLTTAKFILYYGPTVADSDIYDLTDFQSLLEDEHLDLGKNTVLYLHGYLEDP 72

  Fly    67 THGSIMPLRNAYTAQGYENVLVADWGPVANLDY-----PSSRLAVKNVAQILAKLLEEFLQRHGI 126
            ...||..:..||..:...|::|.|||.:|:.:|     |:.:.....:|::|.|:.:     ||:
  Fly    73 DVESIHVIAEAYLERKDTNLIVLDWGELADGNYMFDAFPNLKQLGPELAKVLLKMFD-----HGL 132

  Fly   127 SLEGVHVIGHSLGAHIAGRIGRYFN------GSLGRVTGLDPALPLFSSRSDDSLHSNAAQFVDV 185
            .:|..|::|||:|..:||.:||...      ..:.|::.||||.|||...:  .|.:|.|:||||
  Fly   133 DIEKFHIVGHSMGGQLAGLLGREITKRTKGVRKIKRISALDPAFPLFYPGT--HLSANDAEFVDV 195

  Fly   186 IHTDYPLFGDIRPRGTVDFYPNFGLAPQPGCENVDVVAASKLLHEAYSCSHNRAVMFYAESIGMP 250
            ||||..|:|.....||.||:||.|.:.||||...:.    |:|.:....||.|:..|:|||:.  
  Fly   196 IHTDAWLYGAPTSTGTADFWPNGGYSLQPGCPKRNY----KMLSDNDLSSHRRSWWFWAESVS-- 254

  Fly   251 ENFPAVSCSLTAIKSRRVEDCLREKSKTNTENANDYQTVFMGEHVNRSATLYYYLETNGAPPYGQ 315
            :.:|   ....|:.:::..|..:.|...|.      ..|.||.|...:....:||:|||..|:.:
  Fly   255 DRYP---IGFDAVPAKKWSDFKQNKIVENC------PPVVMGHHCPTTIHGDFYLQTNGHTPFAR 310

  Fly   316 GR 317
            |:
  Fly   311 GK 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10357NP_647821.2 Pancreat_lipase_like 28..308 CDD:238363 92/299 (31%)
CG17292NP_001285749.1 Pancreat_lipase_like 23..303 CDD:238363 92/301 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.