DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10357 and CG14034

DIOPT Version :9

Sequence 1:NP_647821.2 Gene:CG10357 / 38435 FlyBaseID:FBgn0035453 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001036339.1 Gene:CG14034 / 33751 FlyBaseID:FBgn0250847 Length:338 Species:Drosophila melanogaster


Alignment Length:340 Identity:109/340 - (32%)
Similarity:159/340 - (46%) Gaps:72/340 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LGLHAALLDSLLNQSTIYYLK----PSADVSL-----ENVE--QLSSVE----------SVKLIV 59
            :|..:.:|.:.|:....:.|:    |:|::|.     ||.|  :||..|          .:|:::
  Fly     9 IGFSSVMLVAGLDDMNCFSLQNEICPNANISFWLYTKENQEGTKLSVFELNRFEFYHHKPLKVLI 73

  Fly    60 HGYLGSCTHGSIMP---LRNAYTAQGYENVLVADWGPVANLDYPSSRLA-----------VKNVA 110
            ||:.|   |....|   ||..:..|.|.         :.:||||  :||           .|.||
  Fly    74 HGFNG---HRDFSPNTQLRPLFLTQDYN---------LISLDYP--KLAYEPCYTEAVHNAKYVA 124

  Fly   111 QILAKLLEEFLQRHGISLEGVHVIGHSLGAHIAGRIGRYF-NGSLGRVTGLDPALPLFSSRSDD- 173
            :..|:||...|:...:.:|.:|:||..||||:||.||::. ...|..:|.||||.|.:..:... 
  Fly   125 RCTAQLLRVLLESGLVKIEDLHLIGLGLGAHVAGFIGQFLPEHKLEHITALDPAKPFYMVKDPAL 189

  Fly   174 SLHSNAAQFVDVIHTDYPLFGDIRPRGTVDFYPNFGLAPQPGCENVDVVAASKLLHEAYSCSHNR 238
            .|....|:||||:|||..:.|.:...|.||||.|.|:: ||.|..::.:       |.:.|.|||
  Fly   190 KLDPTDAKFVDVVHTDVTMLGLLDAVGHVDFYLNMGVS-QPNCGPINKM-------ETHFCYHNR 246

  Fly   239 AVMFYAESIGMPENFPAVSCSLTAIKSRRVEDCLREKSKTNTENANDYQTVFMGEHVNRSATLYY 303
            |..:|||||..|..|....|  ...||.....|:.:|   |.|        .||.||:..|...|
  Fly   247 AADYYAESISSPSGFYGFYC--PNFKSFAKGICIPDK---NIE--------LMGFHVDPKARGRY 298

  Fly   304 YLETNGAPPYGQGRN 318
            :|:||..|||.:|.|
  Fly   299 FLDTNNGPPYAKGEN 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10357NP_647821.2 Pancreat_lipase_like 28..308 CDD:238363 99/316 (31%)
CG14034NP_001036339.1 Pancreat_lipase_like 37..303 CDD:238363 96/300 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.759104 Normalized mean entropy S7741
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.