DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10357 and pla1a

DIOPT Version :9

Sequence 1:NP_647821.2 Gene:CG10357 / 38435 FlyBaseID:FBgn0035453 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_996939.1 Gene:pla1a / 334017 ZFINID:ZDB-GENE-030131-5949 Length:456 Species:Danio rerio


Alignment Length:221 Identity:87/221 - (39%)
Similarity:114/221 - (51%) Gaps:29/221 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 KLIVHGY--LGSCTHGSIMPLRNAYTAQGYENVLVADWGPVANLDYPSSRLAVKNVAQILAKL-- 116
            |:|||||  ||| ....:..|..|...:...||||.||...|:..|   .|.|:|..::..::  
Zfish    88 KVIVHGYRALGS-KPSWVSGLAQALLREEDVNVLVVDWVYGASFAY---NLVVENYKEVAVQISV 148

  Fly   117 LEEFLQRHGISLEGVHVIGHSLGAHIAGRIGRYFNGSLGRVTGLDPALPLFSSRSD-DSLHSNAA 180
            |...|.::|.:||..|.||.|||||::|.:|..|:|.|||:||||||.|:|.|... |.|.|:.|
Zfish   149 LINQLTKYGSTLESFHFIGVSLGAHVSGFVGTLFHGKLGRITGLDPAGPMFKSADPFDRLDSSDA 213

  Fly   181 QFVDVIHTDYPLFGDIRPRGTVDFYPNFGLAPQPGCENVDVVAASKL--LHEAYSCSHNRAVMFY 243
            .||:.||||...||...|.|.|||:.|.|: .|.||      |.|:.  ::....|.|.||:..|
Zfish   214 LFVEAIHTDSDYFGISIPVGHVDFFLNGGM-DQAGC------ARSRFASMYGYVICDHMRALHVY 271

  Fly   244 AES-------IGMP----ENFPAVSC 258
            ..:       ||.|    |.|.|..|
Zfish   272 MSALNGSCPLIGFPCSGYEEFLAGKC 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10357NP_647821.2 Pancreat_lipase_like 28..308 CDD:238363 87/221 (39%)
pla1aNP_996939.1 Lipase 21..340 CDD:278576 87/221 (39%)
Pancreat_lipase_like 48..336 CDD:238363 87/221 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.