DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10357 and CG18258

DIOPT Version :9

Sequence 1:NP_647821.2 Gene:CG10357 / 38435 FlyBaseID:FBgn0035453 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_573201.1 Gene:CG18258 / 32708 FlyBaseID:FBgn0265267 Length:468 Species:Drosophila melanogaster


Alignment Length:321 Identity:88/321 - (27%)
Similarity:135/321 - (42%) Gaps:65/321 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 CQFLGLHAALLDSLLNQSTIYYLKPSADVSLENVEQLSSVESVKLIVHGYLGSCTHGSIMPLRNA 77
            ||...:.....:.|.|.:..|..:|:.                 |.:.|:..|..:.:..|:..|
  Fly   182 CQNTSIPLTQAEQLWNTTGFYQDRPTV-----------------LFITGWTTSINNSNSGPVAKA 229

  Fly    78 YTAQGYENVLVADWGPVANLDYPSSRLAVKNVAQILAKLL---------EEFLQRHGISLEGVHV 133
            |..:...|||:.|.....:..|..|.|..:.:...|||.|         ::|           |:
  Fly   230 YLCRNDTNVLILDAANFIDTLYTWSALNTEVIGDYLAKALLRLNTSYVTKQF-----------HL 283

  Fly   134 IGHSLGAHIAGRIGRYFNGSLG-----RVTGLDPALPLFSSRSD-DSLHSNAAQFVDVIHTDYPL 192
            :||||||.|||..||.:....|     |:||||||.|.|...:: :.|.|..|:|||:|||:..:
  Fly   284 VGHSLGAQIAGSAGRNYRRLSGGQILKRITGLDPANPCFYDGNELEGLRSGDARFVDIIHTNPGM 348

  Fly   193 FGDIRPRGTVDFYPNFGLAPQPGCENVDVVAASKLLHEAYSCSHNRAVMFYAESIGMPENFPAVS 257
            ||..:..|..||:....:..:||||::|.:          ||||.|||.::.|::     :|:..
  Fly   349 FGTSKRAGDADFFVQGRIPFKPGCESLDPI----------SCSHQRAVDYWTETV-----YPSNG 398

  Fly   258 CSLTAIKSRRVEDCLREKSKTNTENANDYQTVFMGEHVNRSATLYYYLETNGAPPYGQGRN 318
            ....|.:.:|..:.|......||...       ||.....:....:|:..|...||||..|
  Fly   399 NDFLAKRCKRYSELLLGNYCKNTNTV-------MGYAAKATDLGLFYVGANPEEPYGQNAN 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10357NP_647821.2 Pancreat_lipase_like 28..308 CDD:238363 79/294 (27%)
CG18258NP_573201.1 Pancreat_lipase_like 172..443 CDD:238363 82/310 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.