DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10357 and Yp2

DIOPT Version :9

Sequence 1:NP_647821.2 Gene:CG10357 / 38435 FlyBaseID:FBgn0035453 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001285070.1 Gene:Yp2 / 31938 FlyBaseID:FBgn0005391 Length:442 Species:Drosophila melanogaster


Alignment Length:296 Identity:73/296 - (24%)
Similarity:115/296 - (38%) Gaps:57/296 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 YYLKP--SADVSLENVEQLSSVE---SVKLIVHGYLGSCTHGSIMPLRNAYTAQGYENVLVADWG 92
            |.|:|  :.|.|.|...|.||.|   :.:...:|.......|.::.::.....:.:|..      
  Fly   162 YNLQPYETTDYSNEEQSQRSSSEEQQTQRRKQNGEQDDTKTGDLIVIQLGNAIEDFEQY------ 220

  Fly    93 PVANLDYPSSRLAVKNVAQILAKLLEEFLQRHGISLEGVHVIGHSLGAHIAGRIGRYFNGSLG-- 155
                     :.|.::.:.:|:...|.|......:..|.:|:||....||:||..||.|....|  
  Fly   221 ---------ATLNIERLGEIIGNRLVELTNTVNVPQEIIHLIGSGPAAHVAGVAGRQFTRQTGHK 276

  Fly   156 --RVTGLDPALPLFSSRSD--DSLHSNAAQFVDVIHTDYPLFGDIRPRGTVDFYPNFGLAPQPGC 216
              |:|.|||. .::....:  ..|....|.|||.|||.....|..:....|||:||......||.
  Fly   277 LRRITALDPT-KIYGKPEERLTGLARGDADFVDAIHTSAYGMGTSQRLANVDFFPNGPSTGVPGA 340

  Fly   217 ENVDVVAASKLLHEAYSCSHNRAVMFYAESI--GMPENFPAVSCSLTAIKSRRVEDCLREKSKTN 279
            :|  ||.|:.           ||..::|||:  |...|||:|:.|               ..:..
  Fly   341 DN--VVEATM-----------RATRYFAESVRPGNERNFPSVAAS---------------SYQEY 377

  Fly   280 TENANDYQTVFMGEHVNRSATLYYYLETNGAPPYGQ 315
            .:|....:..:||...:......|.|:.|...|:|:
  Fly   378 KQNKGYGKRGYMGIATDFDLQGDYILQVNSKSPFGR 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10357NP_647821.2 Pancreat_lipase_like 28..308 CDD:238363 70/287 (24%)
Yp2NP_001285070.1 Lipase 97..411 CDD:278576 71/292 (24%)
Abhydrolase <221..407 CDD:304388 57/214 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.