DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10357 and Lipg

DIOPT Version :9

Sequence 1:NP_647821.2 Gene:CG10357 / 38435 FlyBaseID:FBgn0035453 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001012759.1 Gene:Lipg / 291437 RGDID:1310740 Length:493 Species:Rattus norvegicus


Alignment Length:274 Identity:91/274 - (33%)
Similarity:135/274 - (49%) Gaps:35/274 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 IVHGY-----LGSCTHGSIMPLRNAYTAQGYENVLVADWGPVANLDY----PSSRLAVKNVAQIL 113
            |:||:     ..|..|..:..|:   |.:...||:|.||.|:|:..|    .::|:..:.||.:|
  Rat    90 IIHGWTMSGMFESWLHKLVSALQ---TREKEANVVVVDWLPLAHQLYIDAVSNTRVVGRRVAGML 151

  Fly   114 AKLLEEFLQRHG-ISLEGVHVIGHSLGAHIAGRIGRYFNGSLGRVTGLDPALPLFSSRS-DDSLH 176
                 .:||..| .||..||:||:|||||:||..|.:..|::||:||||||.|:|.... :..|.
  Rat   152 -----NWLQEKGEFSLGDVHLIGYSLGAHVAGYAGNFVKGTVGRITGLDPAGPMFEGVDINRRLS 211

  Fly   177 SNAAQFVDVIHTDYPLFG---DIR-PRGTVDFYPNFGLAPQPGCENVDVVA--ASKLLHEAYSCS 235
            .:.|.||||:||....||   .|| |.|.:|.|||.| ..||||...||:.  |...:.|...|.
  Rat   212 PDDADFVDVLHTYTLSFGLSIGIRMPVGHIDIYPNGG-DFQPGCGFNDVMGSFAYGTISEMVKCE 275

  Fly   236 HNRAVMFYAESIGMPENFPAVSCSLTAIKSRRVEDCLR-EKSKTNTENANDYQTVFMGEHVNRSA 299
            |.|||..:.:|: :.::.|:.:...|.....:...||. .|::.|....|       .:.:.:..
  Rat   276 HERAVHLFVDSL-VNQDKPSFAFQCTDPNRFKRGICLSCRKNRCNNIGYN-------AKKMRKKR 332

  Fly   300 TLYYYLETNGAPPY 313
            ....||:|....|:
  Rat   333 NSKMYLKTRAGMPF 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10357NP_647821.2 Pancreat_lipase_like 28..308 CDD:238363 89/267 (33%)
LipgNP_001012759.1 Pancreat_lipase_like 51..342 CDD:238363 90/268 (34%)
lipo_lipase 53..488 CDD:132274 91/274 (33%)
Heparin-binding. /evidence=ECO:0000250 327..339 1/11 (9%)
PLAT_LPL 349..485 CDD:238856
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.