DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10357 and LIPH

DIOPT Version :9

Sequence 1:NP_647821.2 Gene:CG10357 / 38435 FlyBaseID:FBgn0035453 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_640341.1 Gene:LIPH / 200879 HGNCID:18483 Length:451 Species:Homo sapiens


Alignment Length:266 Identity:90/266 - (33%)
Similarity:134/266 - (50%) Gaps:29/266 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LGLHAALLDSLLNQSTIYY----LKPSADVSLENVEQLSSVESVKLIVHGYLGSCTHGSIMPLRN 76
            |..|:|::.:.||...:.|    |..:..::......|:..:....||||:..:   || .|:..
Human    28 LSFHSAVVGTGLNVRLMLYTRKNLTCAQTINSSAFGNLNVTKKTTFIVHGFRPT---GS-PPVWM 88

  Fly    77 AYTAQGY-----ENVLVADWGPVA-NLDYPSSRLAVKNVAQILAKLLEEFLQRHGISLEGVHVIG 135
            ....:|.     .||:|.||...| .|.|..:....:.||.:|.:.:::.| ..|.||:.:::||
Human    89 DDLVKGLLSVEDMNVVVVDWNRGATTLIYTHASSKTRKVAMVLKEFIDQML-AEGASLDDIYMIG 152

  Fly   136 HSLGAHIAGRIGRYFNGSLGRVTGLDPALPLFSSR-SDDSLHSNAAQFVDVIHTDYPLFGDIRPR 199
            .||||||:|.:|..::|.|||:||||||.|||:.: ..|.|..:.||||||||:|....|...|.
Human   153 VSLGAHISGFVGEMYDGWLGRITGLDPAGPLFNGKPHQDRLDPSDAQFVDVIHSDTDALGYKEPL 217

  Fly   200 GTVDFYPNFGLAPQPGCENVDVVAASKLLHEAYSCSHNRAVMFYAESIGMPENFPAVSCSLTAIK 264
            |.:|||||.|| .||||....:..     .:.:.|.|.|:|..|..|:       ..||::||..
Human   218 GNIDFYPNGGL-DQPGCPKTILGG-----FQYFKCDHQRSVYLYLSSL-------RESCTITAYP 269

  Fly   265 SRRVED 270
            ....:|
Human   270 CDSYQD 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10357NP_647821.2 Pancreat_lipase_like 28..308 CDD:238363 86/254 (34%)
LIPHNP_640341.1 Pancreat_lipase_like 39..303 CDD:238363 87/255 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.