DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10357 and Lipg

DIOPT Version :9

Sequence 1:NP_647821.2 Gene:CG10357 / 38435 FlyBaseID:FBgn0035453 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_034850.3 Gene:Lipg / 16891 MGIID:1341803 Length:500 Species:Mus musculus


Alignment Length:271 Identity:89/271 - (32%)
Similarity:135/271 - (49%) Gaps:29/271 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 IVHGY-----LGSCTHGSIMPLRNAYTAQGYENVLVADWGPVANLDYPSSRLAVKNVAQILAKLL 117
            |:||:     ..|..|..:..|:   ..:...||:|.||.|:|:..|..:....:.|.|.:|.:|
Mouse    88 IIHGWTMSGMFESWLHKLVSALQ---MREKDANVVVVDWLPLAHQLYTDAVNNTRVVGQRVAGML 149

  Fly   118 EEFLQRHGISLEGVHVIGHSLGAHIAGRIGRYFNGSLGRVTGLDPALPLFSSRS-DDSLHSNAAQ 181
            :...::...||..||:||:|||||:||..|.:..|::||:||||||.|:|.... :..|..:.|.
Mouse   150 DWLQEKEEFSLGNVHLIGYSLGAHVAGYAGNFVKGTVGRITGLDPAGPMFEGVDINRRLSPDDAD 214

  Fly   182 FVDVIHTDYPLFG---DIR-PRGTVDFYPNFGLAPQPGCENVDVVA--ASKLLHEAYSCSHNRAV 240
            ||||:||....||   .|| |.|.:|.|||.| ..||||...||:.  |...:.|...|.|.|||
Mouse   215 FVDVLHTYTLSFGLSIGIRMPVGHIDIYPNGG-DFQPGCGFNDVIGSFAYGTISEMVKCEHERAV 278

  Fly   241 MFYAESIGMPENFP--AVSCSLTAIKSRRVEDCLR-EKSKTNTENANDYQTVFMGEHVNRSATLY 302
            ..:.:|: :.::.|  |..|:.::...|.:  ||. .|::.|....|       .:.:.:.....
Mouse   279 HLFVDSL-VNQDKPSFAFQCTDSSRFKRGI--CLSCRKNRCNNIGYN-------AKKMRKKRNSK 333

  Fly   303 YYLETNGAPPY 313
            .||:|....|:
Mouse   334 MYLKTRAGMPF 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10357NP_647821.2 Pancreat_lipase_like 28..308 CDD:238363 87/264 (33%)
LipgNP_034850.3 Pancreat_lipase_like 49..340 CDD:238363 88/265 (33%)
lipo_lipase 51..485 CDD:132274 89/271 (33%)
Heparin-binding. /evidence=ECO:0000250 325..337 1/11 (9%)
PLAT_LPL 347..483 CDD:238856
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R8651
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.