DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10357 and PNLIPRP3

DIOPT Version :9

Sequence 1:NP_647821.2 Gene:CG10357 / 38435 FlyBaseID:FBgn0035453 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001011709.2 Gene:PNLIPRP3 / 119548 HGNCID:23492 Length:467 Species:Homo sapiens


Alignment Length:245 Identity:87/245 - (35%)
Similarity:124/245 - (50%) Gaps:29/245 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 NLDYPSSRL----AVKNVAQI---LAKLLEEFLQRHGISLEGVHVIGHSLGAHIAGRIGRYFNGS 153
            |||:.:...    ||.|:..:   :|..::..:::...|...||:||||||||:||..|....| 
Human   120 NLDWINGSREYIHAVNNLRVVGAEVAYFIDVLMKKFEYSPSKVHLIGHSLGAHLAGEAGSRIPG- 183

  Fly   154 LGRVTGLDPALPLF-SSRSDDSLHSNAAQFVDVIHTDYP--LF----GDIRPRGTVDFYPNFGLA 211
            |||:||||||.|.| ::..:..|..:.|.|||||||:..  ||    |.|...|.:|||||.| .
Human   184 LGRITGLDPAGPFFHNTPKEVRLDPSDANFVDVIHTNAARILFELGVGTIDACGHLDFYPNGG-K 247

  Fly   212 PQPGCENV-------DVVAASKLLHEAYSCSHNRAVMFYAESIGMPENFPAVSC-SLTAIKSRRV 268
            ..||||::       :..|..|.:...:.|:|.|:..||||||..|:.|.|..| |.|:.|:...
Human   248 HMPGCEDLITPLLKFNFNAYKKEMASFFDCNHARSYQFYAESILNPDAFIAYPCRSYTSFKAGNC 312

  Fly   269 EDCLREKSKTNTENANDYQTVFMGEHVNRSATLYYYLETNGAPPYGQGRN 318
            ..|.:|...|....|:.:.  |.....|.|   :|:|.|....|:.:.|:
Human   313 FFCSKEGCPTMGHFADRFH--FKNMKTNGS---HYFLNTGSLSPFARWRH 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10357NP_647821.2 Pancreat_lipase_like 28..308 CDD:238363 84/233 (36%)
PNLIPRP3NP_001011709.2 Lipase 18..352 CDD:278576 85/238 (36%)
Pancreat_lipase_like 52..348 CDD:238363 85/234 (36%)
PLAT_PL 355..467 CDD:238857 1/3 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.