DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10357 and LOC101884800

DIOPT Version :9

Sequence 1:NP_647821.2 Gene:CG10357 / 38435 FlyBaseID:FBgn0035453 Length:321 Species:Drosophila melanogaster
Sequence 2:XP_005174466.1 Gene:LOC101884800 / 101884800 -ID:- Length:530 Species:Danio rerio


Alignment Length:308 Identity:91/308 - (29%)
Similarity:141/308 - (45%) Gaps:53/308 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 YLKPS-----ADVSLENVEQLSSVESVKLIVHGY-LGSCTHGSIMPLRNA-YTAQGYENVLVADW 91
            ||.|.     :|.:.:|..|      ..||:||: :.......:..|..| |..:...||:|.||
Zfish    57 YLVPGQQDSISDCNFKNDSQ------TFLIIHGWSVAGLFESWVYKLVTALYDREPSANVIVVDW 115

  Fly    92 GPVANLDYPSSRLAVKNVAQILAKLLEEFLQRHGISLEGVHVIGHSLGAHIAGRIGRYFNGSLGR 156
            ...||..||.|....:.|...:||.: .:|:.....||.||::|:|||||:||..|...|..:.|
Zfish   116 LDRANKHYPKSAENTRLVGADVAKFV-NWLEELDYPLEKVHLLGYSLGAHVAGVAGNLTNNKVHR 179

  Fly   157 VTGLDPALPLFSSRS-------DDSLHSNAAQFVDVIHTDYPLFGDI-----RPRGTVDFYPNFG 209
            :||||||.|.|.:..       ||      |.||||:||:.....|:     ||.|.||.|||.|
Zfish   180 ITGLDPAGPSFENADILRRLSPDD------ASFVDVLHTNTRGSPDLSIGIQRPVGHVDIYPNGG 238

  Fly   210 LAPQPGC---ENVDVVAASKL--LHEAYSCSHNRAVMFYAESIGMPENFPAVSCSLTAIKSRRVE 269
            .. ||||   ..:.::|...:  :.:...|||.|::..:.:|: :.:.:.:.:....:..|....
Zfish   239 TF-QPGCSIQHTMKLIATCGIYNMDQIVKCSHERSIHLFIDSL-VNQAYQSWAFRCASRDSFNKG 301

  Fly   270 DCLR-EKSKTNTENANDYQTVFMGEHVNR---SATLYYYLETNGAPPY 313
            .||. .|::.||          :|.:|.:   :.:...||:|....|:
Zfish   302 LCLSCRKNRCNT----------LGYNVKKIRSTRSTKMYLKTREMMPF 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10357NP_647821.2 Pancreat_lipase_like 28..308 CDD:238363 89/301 (30%)
LOC101884800XP_005174466.1 lipo_lipase 35..473 CDD:132274 91/308 (30%)
Pancreat_lipase_like 39..335 CDD:238363 90/302 (30%)
PLAT 342..464 CDD:294016
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.