DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10357 and lipg

DIOPT Version :9

Sequence 1:NP_647821.2 Gene:CG10357 / 38435 FlyBaseID:FBgn0035453 Length:321 Species:Drosophila melanogaster
Sequence 2:XP_002934486.2 Gene:lipg / 100498513 XenbaseID:XB-GENE-1011639 Length:500 Species:Xenopus tropicalis


Alignment Length:299 Identity:96/299 - (32%)
Similarity:145/299 - (48%) Gaps:37/299 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 YLKPSADVSLENVEQLSSVESVKLIVHGY-----LGSCTHGSIMPLRNAYTAQGYENVLVADWGP 93
            :|.|..:..|.|....:|.::. :::||:     ..:..|..:..|:.   .:.|.||:|.||..
 Frog    67 FLIPGQEECLGNCNYNTSAKTF-IVIHGWSMSGLFETWLHRLVGALQE---RERYANVIVVDWMN 127

  Fly    94 VANLDYPSSRLAVKN---VAQILAKLLEEFLQRHGISLEGVHVIGHSLGAHIAGRIGRYFNGSLG 155
            :|:..||.   ||.|   |.:.:|.|::...::..:|||.||:||:|||||:||..|.:..|.:|
 Frog   128 LAHQLYPD---AVNNTMVVGKDIAVLMDWLQEKANLSLENVHLIGYSLGAHVAGYAGNFVTGRIG 189

  Fly   156 RVTGLDPALPLF-SSRSDDSLHSNAAQFVDVIHTDYP------LFGDIRPRGTVDFYPNFGLAPQ 213
            |:||||||.|:| .:.:...|..:.|.||||:|| |.      ..|...|.|.:|.|||.| ..|
 Frog   190 RITGLDPAGPMFEGAEAHKRLSPDDADFVDVLHT-YTREALGVSIGIQMPIGHIDIYPNGG-DFQ 252

  Fly   214 PGCENVDVVAASKL--LHEAYSCSHNRAVMFYAESI--GMPENFPAVSCSLTAIKSRRVEDCLRE 274
            |||...||:.|...  :.:|..|.|.|:|..:.:|:  ...|:| |..|:    .|.|.:..:..
 Frog   253 PGCGLSDVLGAIAYGSIGDAVKCEHERSVHLFVDSLIHKDQESF-AFQCT----DSDRFKKGICL 312

  Fly   275 KSKTNTENANDYQTVFMGEHVNRSATLYYYLETNGAPPY 313
            ..:.|..||..|....|....|..    .:|:|....||
 Frog   313 SCRKNRCNAIGYNAKRMRSKRNSK----MFLKTRAQMPY 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10357NP_647821.2 Pancreat_lipase_like 28..308 CDD:238363 93/292 (32%)
lipgXP_002934486.2 lipo_lipase 63..488 CDD:132274 96/299 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R8651
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.130

Return to query results.
Submit another query.