DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10357 and LOC100331214

DIOPT Version :9

Sequence 1:NP_647821.2 Gene:CG10357 / 38435 FlyBaseID:FBgn0035453 Length:321 Species:Drosophila melanogaster
Sequence 2:XP_002666287.3 Gene:LOC100331214 / 100331214 -ID:- Length:501 Species:Danio rerio


Alignment Length:360 Identity:100/360 - (27%)
Similarity:157/360 - (43%) Gaps:70/360 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 ILCQFLGL--------HAALLD-SLLNQSTIYYLKPSADV----------SLEN----------- 45
            :||.||.|        .|||.: ::||....::|:...|:          ||.|           
Zfish     6 LLCVFLWLVLNITGPFIAALEEGNVLNGVFDHFLEDLRDLSDVKKLNVKFSLRNPSQPDDDVCYI 70

  Fly    46 ----VEQLSS-----VESVKLIVHGYLGSCTHGSIMP--LRNAYTAQGYENVLVADWGPVANLDY 99
                .|.|||     .....|::||:..|....|.:.  :...|..:...||:|.||...|...|
Zfish    71 VRGKAETLSSCNFNHTSKTILVIHGWTVSGLFESWVEKLVAALYNREKDANVIVVDWLDTAQDHY 135

  Fly   100 PSSRLAVKNVAQILAKLLEEFLQRHGISLEGVHVIGHSLGAHIAGRIGRYFNGSLGRVTGLDPAL 164
            ..:....|.|.:.:...::...:...:.||.:|:||:|||||:||..|.:....:||:||||||.
Zfish   136 VVAAQNTKMVGREIGLFIDWIEETSNVPLENLHLIGYSLGAHVAGFAGSHTTNKIGRITGLDPAG 200

  Fly   165 PLFSS-RSDDSLHSNAAQFVDVIHTDYPLF---------GDIRPRGTVDFYPNFGLAPQPGCE-- 217
            |.|.. .:...|..:.|.||||:||    |         |..:|.|.||.|||.| :.||||.  
Zfish   201 PDFEGVHAHGRLSPDDAHFVDVLHT----FTRGSLGLSIGIEQPVGHVDIYPNGG-SFQPGCNLR 260

  Fly   218 -NVDVVAASKL--LHEAYSCSHNRAVMFYAESIGMPENF-PAVSCSLTAIKSRRVEDCLREKSKT 278
             .::.:|:..:  ::.|..|.|.|::..:.:|:...|.. .|.||....:..|.|  ||  :.:.
Zfish   261 GALEKMASYGIFAINNAIRCEHERSIHLFIDSLLNEEAAGRAYSCGSNDMFDRGV--CL--QCRK 321

  Fly   279 NTENANDYQTVFMGEHVNRSATLYYYLETNGAPPY 313
            |..|...|..    ..|.::.::..:.:|.|:.|:
Zfish   322 NGCNTVGYDI----SKVRKARSVKMFTKTRGSMPF 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10357NP_647821.2 Pancreat_lipase_like 28..308 CDD:238363 88/327 (27%)
LOC100331214XP_002666287.3 lipo_lipase 47..487 CDD:132274 88/319 (28%)
Pancreat_lipase_like 51..347 CDD:238363 85/308 (28%)
PLAT_LPL 355..485 CDD:238856
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.