DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10359 and ANGPTL1

DIOPT Version :9

Sequence 1:NP_001137882.1 Gene:CG10359 / 38434 FlyBaseID:FBgn0035452 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001363692.1 Gene:ANGPTL1 / 9068 HGNCID:489 Length:491 Species:Homo sapiens


Alignment Length:453 Identity:127/453 - (28%)
Similarity:203/453 - (44%) Gaps:85/453 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 KELMT-----NLHDRVGILVTLDEDQRHRLEVIDKKLD---------QLVESSSARMESMKAQ-Q 119
            |:::|     ||.|.:       ..|:..::|:...:|         :|:...|..|.|...| .
Human    77 KDMITRMDLENLKDVL-------SRQKREIDVLQLVVDVDGNIVNEVKLLRKESRNMNSRVTQLY 134

  Fly   120 LDFLHRL----DSFEHIQRLSRNTLDELKGETDQVFGPRNVRELKHKLRNRKKMKDISRTVRDVS 180
            :..||.:    |:...:.:|....|:.   .|:.:......|||:.|.          .::.|:.
Human   135 MQLLHEIIRKRDNSLELSQLENKILNV---TTEMLKMATRYRELEVKY----------ASLTDLV 186

  Fly   181 QEQYPSSGIGTFNESNLNLSSRLDALATLLASTALSVRSVQVEVANLSRAIRRQSRLIQGKGLRS 245
            ..|  |..|....|..|.:.||.|        |.:|...|||...::..:.:....|:.|..::.
Human   187 NNQ--SVMITLLEEQCLRIFSRQD--------THVSPPLVQVVPQHIPNSQQYTPGLLGGNEIQR 241

  Fly   246 TPGQQPIFYGPSGL-NGPTATR-QLP----------SSCSYSFLSNHGILKV-QLTPESES--FY 295
            .||.......|..| ..||.:. ::|          ..|..:..:.|.:..: .:.||:.:  ..
Human   242 DPGYPRDLMPPPDLATSPTKSPFKIPPVTFINEGPFKDCQQAKEAGHSVSGIYMIKPENSNGPMQ 306

  Fly   296 VSCDED-----WTVILSRTSDDVNFERGWLDYRDGFGNLAGDFFIGLNKLHALTSSALHELRIVM 355
            :.|:..     ||||..||...|||.|.|.:|:.||||:.|::::||..::.|::...::|.|.:
Human   307 LWCENSLDPGGWTVIQKRTDGSVNFFRNWENYKKGFGNIDGEYWLGLENIYMLSNQDNYKLLIEL 371

  Fly   356 EDFSGNVAYAGYSLFAIGSEKELYPLVLLGKFQDNLTPSAGDSLSYHAGAKFSTVDQDNDNCLEC 420
            ||:|....||.||.|.:..|.|.|.| .||.:|.|    ||||:.:|.|.:|:|:|:|.| ....
Human   372 EDWSDKKVYAEYSSFRLEPESEFYRL-RLGTYQGN----AGDSMMWHNGKQFTTLDRDKD-MYAG 430

  Fly   421 NCALRHKGAGWFNNCAKSNL------FGEYTTQNQPGETGIWWDTF-SGQNSLKRVRWMIRPI 476
            |||..|||..|:|.||.|||      .|.|.:::|   .||:|..: .|..||:.|:.||:||
Human   431 NCAHFHKGGWWYNACAHSNLNGVWYRGGHYRSKHQ---DGIFWAEYRGGSYSLRAVQMMIKPI 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10359NP_001137882.1 FReD 267..476 CDD:238040 80/233 (34%)
ANGPTL1NP_001363692.1 PB1 74..138 CDD:383100 13/67 (19%)
FReD 275..490 CDD:238040 79/223 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.