DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10359 and Fgl2

DIOPT Version :9

Sequence 1:NP_001137882.1 Gene:CG10359 / 38434 FlyBaseID:FBgn0035452 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_445907.2 Gene:Fgl2 / 84586 RGDID:620170 Length:429 Species:Rattus norvegicus


Alignment Length:389 Identity:114/389 - (29%)
Similarity:181/389 - (46%) Gaps:70/389 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 TLDELKGETDQVFGPRNVRELKHKLRNRKKMKD-ISRTVRD--VSQEQYP---SSGIGTFNESNL 197
            ||..|..:..|.||  ::.|:..::|..::..| :.::.:|  :..:::|   .:|..|..::.:
  Rat    58 TLPTLTLQLPQQFG--SMEEVLKEVRTLQEAVDSLKKSCQDCKLQADEHPDPGGNGAETAEDNRV 120

  Fly   198 -NLSSRLDALATLLASTALSVRSVQ-------------VE------VANLSRAIRRQSRLIQGKG 242
             .|.|:::.|::.|.:....::.:|             :|      ||||:..:..    :..|.
  Rat   121 QELESQVNKLSSELKNAKEEIQGLQGRLESLQLVNMNNIENYVDNKVANLTSVVNS----LDSKC 181

  Fly   243 LRSTPGQQPIFYGPSGLNGPTATRQL-PSSCS-YSFLSNHGILKVQLTPE--SESFYVSCDED-- 301
            .: .|.|:.        |.|...:.| ...|| |..|........::||:  :.||.|.||.:  
  Rat   182 FK-CPSQEH--------NQPNPVQHLIYKDCSDYYVLGKRSSGTYRVTPDHRNSSFEVYCDMETT 237

  Fly   302 ---WTVILSRTSDDVNFERGWLDYRDGFGNLAGDFFIGLNKLHALTSSALHELRIVMEDFSGNVA 363
               |||:.:|.....||.|||.||:.|||||..:|::|.:|:|.||.|....|||.:|||:|...
  Rat   238 GGGWTVLQARLDGSTNFTRGWKDYKAGFGNLEREFWLGNDKIHLLTKSKEMILRIDLEDFNGLTL 302

  Fly   364 YAGYSLFAIGSEKELYPLVLLGKFQDNLTPSAGDSLSY-----HAGAKFSTVDQDNDNCLECNCA 423
            ||.|..|.:.:|...|.|.|     .|...:|||:|.:     |....|:|.|:|||.....||.
  Rat   303 YAVYDQFYVANEFLKYRLHL-----GNYNGTAGDALRFSRHYNHDLRFFTTPDRDNDRYPSGNCG 362

  Fly   424 LRHKGAGWFNNCAKSNLFGEYTTQNQPG-ETGIWWDTFSGQN---------SLKRVRWMIRPIS 477
            |.:....||:.|..:||.|:|..|...| ..||:|.|:.|.:         |.|:.:.||||.|
  Rat   363 LYYSSGWWFDACLSANLNGKYYHQRYKGVRNGIFWGTWPGVSQAHPGGYKFSFKKAKMMIRPKS 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10359NP_001137882.1 FReD 267..476 CDD:238040 84/232 (36%)
Fgl2NP_445907.2 ApoLp-III_like <71..177 CDD:304399 18/111 (16%)
Fibrinogen_C 199..425 CDD:278572 83/230 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.