DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10359 and Angptl7

DIOPT Version :9

Sequence 1:NP_001137882.1 Gene:CG10359 / 38434 FlyBaseID:FBgn0035452 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001034643.1 Gene:Angptl7 / 654812 MGIID:3605801 Length:337 Species:Mus musculus


Alignment Length:345 Identity:108/345 - (31%)
Similarity:150/345 - (43%) Gaps:77/345 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 VRELKHKLRN---------RKKMKDISRTVRDVSQEQYPSSGIGTFNESNLNLSSRLDALATLLA 211
            :||||.::.|         ||:..|....|..|.:          ...|:.::.|||..     |
Mouse    40 MRELKAQVANLSSLLGELSRKQESDWVSVVMQVME----------LESSSKHMESRLST-----A 89

  Fly   212 STALSVRSVQVEVANLSRAIRRQSRLIQGKGLRSTPGQQPIFYGPSGLNGPTATRQLPSS---CS 273
            .:..|..:.|:::..|..|                               .|.|:....:   ||
Mouse    90 ESKYSEMNNQIDIMQLQAA-------------------------------QTVTQTSADAIYDCS 123

  Fly   274 YSFLSNHGILKVQLTPESE-----SFYVSCDED-----WTVILSRTSDDVNFERGWLDYRDGFGN 328
            ..:..|:.|..|...|..|     ...|.||.:     ||:|..|.|..|:|.:.|..|:.|||:
Mouse   124 SLYQKNYRISGVYKLPPDEFLGSPELEVFCDMETSGGGWTIIQRRKSGLVSFYQDWRQYKQGFGS 188

  Fly   329 LAGDFFIGLNKLHALTSSALHELRIVMEDFSGNVAYAGYSLFAIGSEKELYPLVLLGKFQDNLTP 393
            :.|||::|...:|.||... ..||:.:||:.||..||.||.||:|:|...|.| .||.:..|:  
Mouse   189 IRGDFWLGNEHIHRLTRQP-SRLRVELEDWEGNARYAEYSYFALGNELNSYRL-FLGNYSGNV-- 249

  Fly   394 SAGDSLSYHAGAKFSTVDQDNDNCLECNCALRHKGAGWFNNCAKSNLFGEY--TTQNQPGETGIW 456
             ..|:|.||....|||.|:||||||: .||...||..|:|.|..|||.|.|  ..:::....||.
Mouse   250 -GKDALLYHNNTVFSTKDKDNDNCLD-KCAQLRKGGYWYNCCTDSNLNGVYYRLGEHRKHMDGIS 312

  Fly   457 WDTFSGQN-SLKRVRWMIRP 475
            |..:.|.| |||||...|||
Mouse   313 WYGWHGANYSLKRVEMKIRP 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10359NP_001137882.1 FReD 267..476 CDD:238040 87/225 (39%)
Angptl7NP_001034643.1 FReD 120..332 CDD:238040 85/217 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.