DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10359 and angpt4

DIOPT Version :9

Sequence 1:NP_001137882.1 Gene:CG10359 / 38434 FlyBaseID:FBgn0035452 Length:485 Species:Drosophila melanogaster
Sequence 2:XP_005166327.1 Gene:angpt4 / 571050 ZFINID:ZDB-GENE-110104-1 Length:496 Species:Danio rerio


Alignment Length:427 Identity:121/427 - (28%)
Similarity:188/427 - (44%) Gaps:87/427 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 ELMTNLHDRVGILVTLDEDQRHRLEVIDKKL--------DQLVES--SSARMESMKAQQLDFLHR 125
            |:.||       |::...:|..:|.|::.|:        .||:|:  |:.::|.....||..:.:
Zfish   132 EIGTN-------LLSQTAEQSRKLNVVEAKVMNQTSRIAIQLLENSLSTNKLEKELISQLSEISK 189

  Fly   126 L-DSFEHIQRLSRNTLDELKGETDQVFGPRNVRELKHKLRNRKKMKDISRTVRDVSQEQYPSSGI 189
            | |...|::  |:..:.|.:..|:.    .::||.|.:|::..|.:..:.|..: .|.:..||..
Zfish   190 LRDKNSHLE--SKVLVLESQQRTEL----EDMREEKERLQDLVKRQTAAITALE-RQLRAASSNN 247

  Fly   190 GTFNESNLNLSSRLDALATLLASTALSVRSVQVEVANLSRAIRRQSRLIQGKGLRSTPGQQPIFY 254
            ....:.:..|...:..|..:::|                           |.|:  ||.:|..  
Zfish   248 SALQKQHQQLMKSVHTLIGMVSS---------------------------GTGI--TPNEQRF-- 281

  Fly   255 GPSGLNGPTATRQLPSSCSYSFLSNH---GILKVQLTPESESFYVSCD-----EDWTVILSRTSD 311
                           ..|:.::.|.|   |:..:.:...:|...|.||     ..|||...|.:.
Zfish   282 ---------------RDCAEAYKSGHNTSGVYHIYIGDMTEPTKVFCDMVTSGGGWTVFQHRANG 331

  Fly   312 DVNFERGWLDYRDGFGNLAGDFFIGLNKLHALTSSALHELRIVMEDFSGNVAYAGYSLFAIGSEK 376
            .|||::||.||:.|||:.:|:.::|...:|.:||...:.||:.::|:..|.|||.|..|.:.|||
Zfish   332 SVNFQKGWKDYKLGFGDPSGEHWLGNEAIHLITSQGQYSLRVELKDWEENGAYALYDKFQLTSEK 396

  Fly   377 ELYPLVLLGKFQDNLTPSAGDSLSYHAGAKFSTVDQDNDNCLECNCALRHKGAGWFNNCAKSNLF 441
            :.|.| |||....  |.....||:.: |..|||.|.|||.| ||.|||...|..||..|..|||.
Zfish   397 QQYRL-LLGSHSG--TAGQKSSLALN-GTGFSTRDADNDKC-ECKCALMMTGGWWFEACGMSNLN 456

  Fly   442 GEYTT--QNQPGETGIWWDTFSGQN-SLKRVRWMIRP 475
            |.|.|  .|.....||.|..|.|.: ||:....||||
Zfish   457 GIYYTIGHNIRKLNGIKWHHFRGPSYSLQSTSMMIRP 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10359NP_001137882.1 FReD 267..476 CDD:238040 83/220 (38%)
angpt4XP_005166327.1 Uso1_p115_C 175..>258 CDD:282695 18/89 (20%)
FReD 281..493 CDD:238040 81/233 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.