DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10359 and LOC566119

DIOPT Version :9

Sequence 1:NP_001137882.1 Gene:CG10359 / 38434 FlyBaseID:FBgn0035452 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001315003.1 Gene:LOC566119 / 566119 -ID:- Length:245 Species:Danio rerio


Alignment Length:226 Identity:79/226 - (34%)
Similarity:112/226 - (49%) Gaps:21/226 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   266 RQLPSSCSYSFLSNHGILKV-QLTPESE-SFYVSC-------DED---WTVILSRTSDDVNFERG 318
            |..|..||:.:.|.....|| .:.|:.: ..:..|       |||   ||||..|....:||.:.
Zfish    22 RYKPLDCSHHYKSGERFSKVYTIHPDGDHPHHAFCHMVSDGRDEDNGGWTVIQRRMDGTLNFYQP 86

  Fly   319 WLDYRDGFGNLAGDFFIGLNKLHALTSSALHELRIVMEDFSGNVAYAGYSLFAIGSEKELYPLVL 383
            |.:|:.|||::.|:.::||..:|.:|....|.||:.||||.|...:|.|:.|::.||.:.|.|.:
Zfish    87 WKEYKRGFGSMEGEHWMGLEHIHHMTRHKRHMLRVDMEDFEGRRGFAHYTSFSVASEDDGYKLHI 151

  Fly   384 LGKFQDNLTPSAGDSLSYHAGAKFSTVDQDNDNCLECNCALRHKGAGWFNNCAKSNLFGEYTTQN 448
            .| |:|.   .|||||:.|...||||.|:|.| ..|.|||....|..|:..|..:|..|.|...:
Zfish   152 SG-FRDG---GAGDSLTAHNEMKFSTFDKDQD-LYEKNCAREFLGGFWYKKCHHANPNGVYLWGH 211

  Fly   449 QPGETGI---WWD-TFSGQNSLKRVRWMIRP 475
            ......|   ||. ..:..||||.:...|:|
Zfish   212 DRTHYAIGVCWWSWDHNYYNSLKHITMRIKP 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10359NP_001137882.1 FReD 267..476 CDD:238040 78/225 (35%)
LOC566119NP_001315003.1 FReD 25..242 CDD:238040 77/221 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100073
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.