DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10359 and fgl2a

DIOPT Version :9

Sequence 1:NP_001137882.1 Gene:CG10359 / 38434 FlyBaseID:FBgn0035452 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001020710.1 Gene:fgl2a / 565637 ZFINID:ZDB-GENE-030131-9506 Length:451 Species:Danio rerio


Alignment Length:415 Identity:114/415 - (27%)
Similarity:178/415 - (42%) Gaps:83/415 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 QLVESSSARMESMKAQQLDFLHRLDSFEHIQRLSRNTLDELKGETDQVFGPRNVRELKHKLRNRK 167
            :|:|.:...::|:|             |.:.||..:.|:               ..||....|.:
Zfish    73 RLLEKTVKELQSLK-------------ETVNRLKSSCLE---------------CSLKQVDLNLQ 109

  Fly   168 KMKDISRTVRDVSQEQYPSSGIGTFNESN----LNLSSRLDALATLLASTALSVRSVQ------- 221
            |......|..:.|:.|.....|...|:|:    .|:..:::.:::.|.:....:.|:|       
Zfish   110 KDSGDPPTEGEQSRGQTSMRVIHNGNDSDNDIVQNMQVKMNRMSSSLKNARAQINSLQGRLEELN 174

  Fly   222 -VEVANLSRAIRRQSRLIQG------KGLRSTPGQQPIFYGPSGLNGPTATRQLPSSCSYSFLSN 279
             :.:.|:...:.|:...|.|      ....|.||||        |.....|...|..||...:..
Zfish   175 LLNLQNVENIVDRKVENITGMVNKISSTCTSCPGQQ--------LQLQHLTNIPPRDCSDISMLG 231

  Fly   280 HGILKV-QLTPE--SESFYVSCDED-----WTVILSRTSDDVNFERGWLDYRDGFGNLAGDFFIG 336
            ..|.|| |:||:  :.||.|.||.:     ||||..|.:..|:|.|.|.||:.|||||..:|::|
Zfish   232 QRINKVYQVTPDPRNGSFAVYCDMESFGGGWTVIQHRINGSVSFNRTWADYKKGFGNLNSEFWLG 296

  Fly   337 LNKLHALTSSALHELRIVMEDFSGNVAYAGYSLFAIGSEKELYPLVLLGKFQDNLTPSAGDSLSY 401
            .:|:|.||.:....|||.:||..|...||.|..|.:.:|...|.|.:.|     .:.:||::|.:
Zfish   297 NDKIHLLTKAKDMILRIELEDSEGTRGYAKYDQFYVSNEFLHYRLSVSG-----YSGTAGNALQF 356

  Fly   402 -----HAGAKFSTVDQDNDNCLECNCALRHKGAGWFNNCAKSNLFGEYTTQNQPGE-TGIWWDTF 460
                 |....|:|.|:|||.....||...:....||:.|..:||.|:|......|: .||:|.|:
Zfish   357 SKHFNHDQKFFTTPDKDNDRYPSGNCGAYYGSGWWFDACMSANLNGKYYKTKYKGKRDGIFWGTW 421

  Fly   461 ----------SGQNSLKRVRWMIRP 475
                      |.:.:.|.|:.||||
Zfish   422 PNATSEYYPTSFRQAYKNVKMMIRP 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10359NP_001137882.1 FReD 267..476 CDD:238040 81/233 (35%)
fgl2aNP_001020710.1 FReD 219..447 CDD:238040 81/233 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.