DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10359 and si:ch211-203k16.3

DIOPT Version :9

Sequence 1:NP_001137882.1 Gene:CG10359 / 38434 FlyBaseID:FBgn0035452 Length:485 Species:Drosophila melanogaster
Sequence 2:XP_021324371.1 Gene:si:ch211-203k16.3 / 559151 ZFINID:ZDB-GENE-041014-290 Length:425 Species:Danio rerio


Alignment Length:437 Identity:123/437 - (28%)
Similarity:186/437 - (42%) Gaps:76/437 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 LVTLDEDQRHRLEVIDKKLDQLVESSSARMESMKAQQLDFLHRLDSFEHIQRLSRNT------LD 141
            |:|...|.:|.|........|..|.|:..:|....:.:..|.:||. :....:.|.|      |.
Zfish    16 LLTHASDDQHSLHTHQVSTAQCGEYSNQVLEDGMCRLMATLPQLDE-QRCPDMFRCTDEVSYWLH 79

  Fly   142 ELKGETDQVFG-PRNVRELKHKLRN-RKKMKDISRTVRDVSQEQYPSSGIGTFNESNLNLSSRLD 204
            |.:....|:.. ...|.||:.:||| |.::|     |.::..|:.        |.::.::..||.
Zfish    80 ENEERKQQILALKETVSELQEELRNHRHRVK-----VLELQSEEK--------NHNSSSIEQRLH 131

  Fly   205 AL-------ATLLASTALSVRSVQVEVANLSRAIRRQSRLIQGKGLRSTPG-------QQPIFYG 255
            .|       :|||......:..:|.::.|||..:.:         :|..||       ..|:...
Zfish   132 ELENHYAEASTLLHIQGSLIYDLQAQIHNLSMLVEK---------VRRNPGCMINIVRTSPLINA 187

  Fly   256 PSGLNGPTA-TRQLPSSCS---YSFLSNHGILKVQLTPESESFYVSCDED-----WTVILSRTSD 311
            ...|:.... .|..|..|:   |:.:...||..|..:..:....|.||.|     ||||..|...
Zfish   188 QEALHPEVQNVRNCPIDCASIYYNGVRRSGIYTVVPSLGAMPVEVYCDMDTDGGGWTVIQRRQDG 252

  Fly   312 DVNFERGWLDYRDGFGNLAGDFFIGLNKLHALTSSALHELRIVMEDFSGNVAYAGYSLFAIGSEK 376
            .|||:|.|.:|::|||:|..::::|...:|.|||...:.|||.:||:|....:|.|..|::..|.
Zfish   253 SVNFDRSWKEYKEGFGDLHTEYWLGNEHIHDLTSQGDYMLRIDLEDWSNKHKHALYQSFSVEDEN 317

  Fly   377 ELYPLVLLGKFQDNLTPSAGDSLS-YHAGAKFSTVDQDNDNCLECNCALRHKGAGWFNNCAKSNL 440
            ..|.|.:.|     .:.:..||.| ||....|||.|..| .|.|    :.|.| .|:|.|..:||
Zfish   318 TQYRLHVSG-----FSGTVEDSFSWYHDKQGFSTPDTGN-ICAE----ISHAG-WWYNQCFYTNL 371

  Fly   441 FGEY--------TTQNQPGETGIWWDTF--SGQNSLKRVRWMIRPIS 477
            .|.|        ..:|..|..|:.|.|:  |...||:||..||||.|
Zfish   372 NGIYYKGGRYSLKGKNSLGPDGVVWFTWKDSDYYSLRRVSMMIRPKS 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10359NP_001137882.1 FReD 267..476 CDD:238040 77/227 (34%)
si:ch211-203k16.3XP_021324371.1 SMC_N 73..>158 CDD:330553 21/97 (22%)
FReD 202..417 CDD:238040 77/225 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.