DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10359 and MGC107780

DIOPT Version :9

Sequence 1:NP_001137882.1 Gene:CG10359 / 38434 FlyBaseID:FBgn0035452 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001015692.1 Gene:MGC107780 / 548409 -ID:- Length:308 Species:Xenopus tropicalis


Alignment Length:252 Identity:84/252 - (33%)
Similarity:117/252 - (46%) Gaps:27/252 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 GLRSTPGQQPIFYGPSGLNGPT-------ATRQLPSSCSYSFLSNHGILK---VQLTPESE-SFY 295
            |.:..||:.    ||.|..|..       |..|..::.:...|.:.|.:.   .::.|:.| ...
 Frog    65 GSKGEPGKA----GPQGQQGQKGDKGDGGAPEQFYAARNCKELLDQGAILSGWYKIYPDGERPLT 125

  Fly   296 VSCDED-----WTVILSRTSDDVNFERGWLDYRDGFGNLAGDFFIGLNKLHALTSSALHELRIVM 355
            |.||.|     |.|...|....|:|.|.|..|:.|||:...:|::|.:.:|.|||:..::|||..
 Frog   126 VLCDMDTDGGGWIVFQRRWDGSVDFFRDWDSYKKGFGSQLSEFWLGNDNIHTLTSAGTYKLRIDF 190

  Fly   356 EDFSGNVAYAGYSLFAIGSEKELYPLVLLGKFQDNLTPSAGDSLSYHAGAKFSTVDQDNDNCLEC 420
            .||....::|.|..||...||:.|.|: ||.:...   :|||||::|....|||.|:||| ....
 Frog   191 TDFENQNSFAAYDSFATLGEKDNYKLI-LGAYSGG---TAGDSLNHHRNCPFSTKDRDND-FHNI 250

  Fly   421 NCALRHKGAGWFNNCAKSNLFGEYTTQNQPGET-GIWWDTFSGQN-SLKRVRWMIRP 475
            |||...||..|:.:|..|||.|.|.......|. ||.|:|..|.. |.|......||
 Frog   251 NCADTFKGGWWYGSCHDSNLNGLYLRGKHSNEALGINWETGKGNGYSYKVTEMKFRP 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10359NP_001137882.1 FReD 267..476 CDD:238040 76/220 (35%)
MGC107780NP_001015692.1 Collagen 41..>70 CDD:189968 1/4 (25%)
FReD 98..308 CDD:238040 75/215 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.