DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10359 and fcn2

DIOPT Version :9

Sequence 1:NP_001137882.1 Gene:CG10359 / 38434 FlyBaseID:FBgn0035452 Length:485 Species:Drosophila melanogaster
Sequence 2:XP_031747902.1 Gene:fcn2 / 548398 XenbaseID:XB-GENE-5789613 Length:312 Species:Xenopus tropicalis


Alignment Length:288 Identity:87/288 - (30%)
Similarity:121/288 - (42%) Gaps:62/288 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   237 LIQG-KGLRSTPGQQ----------PIFYGPSGLNGPTATRQLP--------------------- 269
            :|:| .|:..:|||:          |.  ||.|..||...:..|                     
 Frog    38 IIRGCPGIPGSPGQKGEQGENGRVGPA--GPPGKMGPPGMKGAPGESIKGEKGDKGDSGRLDSLY 100

  Fly   270 --SSCSYSFLSNHGILKVQLT--PE-SESFYVSCD-----EDWTVILSRTSDDVNFERGWLDYRD 324
              .:|. ..|....||....|  || ::...|.||     ..|.|...|....|||.|.|..|:.
 Frog   101 AAKNCK-ELLDQGEILTDWYTIYPENTQPMKVLCDMHTDGGGWIVFQRRWDGSVNFNRDWNSYKT 164

  Fly   325 GFGNLAGDFFIGLNKLHALTSSALHELRIVMEDFSGNVAYAGYSLFAIGSEKELYPLVLLGKFQD 389
            ||||...:|::|...|:.||||...||||.::||.....:..||.|.:..|.:.|.| |||..::
 Frog   165 GFGNRLNEFWLGNENLYELTSSGTWELRIELQDFENVNYFVIYSSFKLLGEADKYKL-LLGNLKE 228

  Fly   390 NLTPSAGDSLSYHAGAKFSTVDQDNDNCLECNCALRHKGAGWFNNCAKSNLFGEYTTQNQPGE-- 452
            .   :.|:|:..|....|||:|.|   .....|..::||..|:|:|..:||.|.|.    ||:  
 Frog   229 G---NIGNSMDVHVNMPFSTLDND---VSPGKCVAKYKGGWWYNDCHHANLNGPYL----PGQHS 283

  Fly   453 ---TGIWWDTFSGQN-SLKRVRWMIRPI 476
               .||.|.:..|.: |.|.....|||:
 Frog   284 SYADGINWASGKGYHYSYKHSEMKIRPV 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10359NP_001137882.1 FReD 267..476 CDD:238040 74/245 (30%)
fcn2XP_031747902.1 FReD 103..311 CDD:238040 73/219 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.