DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10359 and ANGPT4

DIOPT Version :9

Sequence 1:NP_001137882.1 Gene:CG10359 / 38434 FlyBaseID:FBgn0035452 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_057069.1 Gene:ANGPT4 / 51378 HGNCID:487 Length:503 Species:Homo sapiens


Alignment Length:524 Identity:145/524 - (27%)
Similarity:220/524 - (41%) Gaps:114/524 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 TVMVLAAICGFGTGSVLEVPGVTQAPPLPPRNLRNNQTRSRIPNNFRSIATP---PIAPRCDYKE 71
            |::|....|.:    ...:|.....|| .|...|::.|..|     .|:|.|   ...|....|:
Human    35 TLVVQHGHCSY----TFLLPKSEPCPP-GPEVSRDSNTLQR-----ESLANPLHLGKLPTQQVKQ 89

  Fly    72 LMTNLHDRVGILVTLDED----QRHRLEVIDKKLDQ------------LVESSSA---RMESMKA 117
            |...|.:....|..|:..    .|.:||.:.:::.|            |:..::|   ::..|:|
Human    90 LEQALQNNTQWLKKLERAIKTILRSKLEQVQQQMAQNQTAPMLELGTSLLNQTTAQIRKLTDMEA 154

  Fly   118 QQLDFLHRLDSFEHIQRLSRNTLDELKGETDQVFGPRNVRELKHKLRNRKKMKDISRTVRDVSQE 182
            |.|:...|:|:......||.|.|:                  ...|..|:|::.:        |.
Human   155 QLLNQTSRMDAQMPETFLSTNKLE------------------NQLLLQRQKLQQL--------QG 193

  Fly   183 QYPSSGIGTFNESNLNLSSRLDALATLLASTALSVRSVQVEVAN-LS-------------RAIRR 233
            |            |..|..||.||.|.......|:.|.:.::.| ||             |.:|.
Human   194 Q------------NSALEKRLQALETKQQEELASILSKKAKLLNTLSRQSAALTNIERGLRGVRH 246

  Fly   234 QSRLIQGKG---------LRSTPGQQPIFYGPSGLNGPTATRQLPSSCS---YSFLSNHGILKVQ 286
            .|.|:|.:.         ||....::.....|:.:   .|..|:...|:   .|..|..|:..:|
Human   247 NSSLLQDQQHSLRQLLVLLRHLVQERANASAPAFI---MAGEQVFQDCAEIQRSGASASGVYTIQ 308

  Fly   287 LTPESESFYVSCDED-----WTVILSRTSDDVNFERGWLDYRDGFGNLAGDFFIGLNKLHALTSS 346
            ::..::...|.||..     ||:|..|.:..|||:|.|.||:.|||:.||:.::|...:|.||..
Human   309 VSNATKPRKVFCDLQSSGGRWTLIQRRENGTVNFQRNWKDYKQGFGDPAGEHWLGNEVVHQLTRR 373

  Fly   347 ALHELRIVMEDFSGNVAYAGYSLFAIGSEKELYPLVLLGKFQDNLTPSAG-DSLSYHAGAKFSTV 410
            |.:.||:.::|:.|:.|||.|..|.:|||.:||.|.::|     .:.||| .|........|||:
Human   374 AAYSLRVELQDWEGHEAYAQYEHFHLGSENQLYRLSVVG-----YSGSAGRQSSLVLQNTSFSTL 433

  Fly   411 DQDNDNCLECNCALRHKGAGWFNNCAKSNLFGEY--TTQNQPGETGIWWDTFSGQN-SLKRVRWM 472
            |.|||:|| |.||....|..||:.|..|||.|.|  ...|:....||.|..|.|.: ||:..|.|
Human   434 DSDNDHCL-CKCAQVMSGGWWFDACGLSNLNGVYYHAPDNKYKMDGIRWHYFKGPSYSLRASRMM 497

  Fly   473 IRPI 476
            |||:
Human   498 IRPL 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10359NP_001137882.1 FReD 267..476 CDD:238040 83/220 (38%)
ANGPT4NP_057069.1 FReD 288..501 CDD:238040 82/218 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.