DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10359 and Angptl3

DIOPT Version :9

Sequence 1:NP_001137882.1 Gene:CG10359 / 38434 FlyBaseID:FBgn0035452 Length:485 Species:Drosophila melanogaster
Sequence 2:XP_006238502.1 Gene:Angptl3 / 502970 RGDID:1564505 Length:455 Species:Rattus norvegicus


Alignment Length:465 Identity:106/465 - (22%)
Similarity:194/465 - (41%) Gaps:107/465 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 NQTRSRIPNNFRSIATPPIAPRCDYK-ELMTNLHDRVGILVTLDEDQRH------RLEVIDKKLD 102
            ::|:.:|.:.|:.:   .|..:|.|. .|.||         .:.|:::.      :|:|.::::.
  Rat    62 HKTKGQINDIFQKL---NIFDQCFYDLSLQTN---------EIKEEEKELRRTTSKLQVKNEEVK 114

  Fly   103 QLVESSSARMESMKAQQLDFLHRLDSFEHIQRLSRNTLDELKGETDQVFGPRNVRELKHKLRNRK 167
            .:....::::||:..:::...||:.:.|          ::|   |..|..|...||.......:.
  Rat   115 NMSLELNSKLESLLEEKMALQHRVRALE----------EQL---TSLVQNPPGAREHPEVTSLKS 166

  Fly   168 KMKDISRTVRDVSQ---EQYPSSGIGTFNESNLNLSSRLDALATLLASTALSVRSVQV-EVANLS 228
            .::....::|::.|   |||..                            ||.:.:|: |:.|..
  Rat   167 FVEQQDNSIRELLQSVEEQYKQ----------------------------LSQQHIQIKEIENQL 203

  Fly   229 RAIRRQ-----SRLIQGKGLRSTPGQQPIFYGPSGLNGPTATRQ--LPSSCSYSF-LSNH--GIL 283
            |....|     |...:.:..|:||        |..|.......|  ||:.||..: ...|  |:.
  Rat   204 RKTGIQEPTENSLYSKPRAPRTTP--------PLHLKEAKNIEQDDLPADCSAIYNRGEHTSGVY 260

  Fly   284 KVQLTPESESFYVSCDED----WTVILSRTSDDVNFERGWLDYRDGFGNLAGDFFIGLNKLHALT 344
            .:: ...|:.|.|.||..    .|:|..|.....||.:.|.:|..|||.|.|:|::||.|::|:.
  Rat   261 TIR-PSSSQVFNVYCDTQSGTPRTLIQHRKDGSQNFNQTWENYEKGFGRLDGEFWLGLEKIYAIV 324

  Fly   345 SSALHELRIVMEDFSGNVAYAGYSLFAIGSEKELYPLVLLGKFQDNLTPSAGDSLSYHAGAKFST 409
            ..:.:.||:.::|:..:..||.|| |.:|:.:..|.|.:.     .:..:..::|..|....|||
  Rat   325 KQSNYILRLELQDWKDSKHYAEYS-FHLGNHETNYTLHVA-----EIAANIPEALPEHRDLMFST 383

  Fly   410 VDQDNDNCLECNCALRHKGAGWFNN-CAKSNLFGEYTTQNQP-------GETGIWWDTFSGQ-NS 465
            .|.....  :..|...:.|..||:: |.::||.|:|   |:|       ...||.|....|: .|
  Rat   384 WDHRAKG--QLYCPESYSGGWWFSDMCGENNLNGKY---NKPRAKSKPERRRGISWRPRGGKLYS 443

  Fly   466 LKRVRWMIRP 475
            :|..:.|::|
  Rat   444 IKSSKMMLQP 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10359NP_001137882.1 FReD 267..476 CDD:238040 65/227 (29%)
Angptl3XP_006238502.1 SPEC <34..193 CDD:295325 30/183 (16%)
FReD 241..453 CDD:238040 63/223 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.