DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10359 and LOC448367

DIOPT Version :9

Sequence 1:NP_001137882.1 Gene:CG10359 / 38434 FlyBaseID:FBgn0035452 Length:485 Species:Drosophila melanogaster
Sequence 2:XP_031746209.1 Gene:LOC448367 / 448367 -ID:- Length:353 Species:Xenopus tropicalis


Alignment Length:394 Identity:120/394 - (30%)
Similarity:160/394 - (40%) Gaps:90/394 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 ESMKAQQLDFLHRLDSFEHIQRLSRNTLD------ELKGETDQVFGPRNVRELKHKLRNRKKMKD 171
            ||.:..||.|  .||.|::.|...| |.|      .:||:|    ||.:|:.|            
 Frog    18 ESNRNFQLRF--DLDDFDNNQTCWR-TADVKVFRVGIKGDT----GPTDVKLL------------ 63

  Fly   172 ISRTVRDVSQEQYPSSGIGTFNESNLNLSSRLDALATLLASTALSVRSVQVEVANLSRAIRRQSR 236
                            |.|.        |.::..|...|.:..|...:...:|..|...  ...:
 Frog    64 ----------------GDGE--------SDKVTILRGCLGAPRLKGDTGSADVKLLGDG--ESDK 102

  Fly   237 LIQGKGLRSTPGQQPIFYGPSGLNGPTA----------TR-QLPSSCSYSFLSNHGIL---KVQL 287
            |:..||....|       ||.||.|.|.          || ..|:..:...|..:|:|   ...:
 Frog   103 LLMQKGCMGPP-------GPPGLKGDTGPAGHQGEKGETRVWYPAVKNCVELRKYGVLFSGWYTI 160

  Fly   288 TPE-SESFYVSCD-----EDWTVILSRTSDDVNFERGWLDYRDGFGNLAGDFFIGLNKLHALTSS 346
            .|: ::..:|.||     ..|.|...|....|:|.|.|..|:.|||:...:|::|...:|.||||
 Frog   161 YPDGNKPLHVLCDMHTDGGGWIVFQKRMDGSVDFYRNWDSYKQGFGSQLSEFWLGNENIHLLTSS 225

  Fly   347 ALHELRIVMEDFSGNVAYAGYSLFAIGSEKELYPLVLLGKFQDNLTPSAGDSLSYHAGAKFSTVD 411
            ...:|||.::||..|..||.||.|.|..|.:.|.| ..|.|...   :||||||.|....|.|.|
 Frog   226 GNFQLRIDLQDFDNNRTYATYSQFRIEPEAQKYTL-RFGAFTGG---TAGDSLSSHNNKAFETGD 286

  Fly   412 QDNDNCLECNCALRHKGAGWFNNCAKSNLFGEYTT----QNQPGETGIWWDTFSGQN-SLKRVRW 471
            ...|..:..|||..:|||.|:..|..|:|.|||..    ||.   .||.|.||.|.| |||:...
 Frog   287 VQYDTSVTANCARMYKGAWWYQKCYDSSLNGEYLRGPLGQNY---GGIAWTTFRGYNYSLKKSEM 348

  Fly   472 MIRP 475
            ..||
 Frog   349 KFRP 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10359NP_001137882.1 FReD 267..476 CDD:238040 81/223 (36%)
LOC448367XP_031746209.1 FReD 139..352 CDD:238040 79/219 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D405297at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.