DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10359 and col11a2

DIOPT Version :9

Sequence 1:NP_001137882.1 Gene:CG10359 / 38434 FlyBaseID:FBgn0035452 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001005799.1 Gene:col11a2 / 448277 XenbaseID:XB-GENE-12564499 Length:340 Species:Xenopus tropicalis


Alignment Length:259 Identity:91/259 - (35%)
Similarity:122/259 - (47%) Gaps:28/259 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   237 LIQGKGLRSTPGQQPIF--------YGPSGLNGPTATRQLPSSCSYSFLSNHGIL-----KVQLT 288
            |:...|.|..||...:.        .||.|.:||...|...:...   |.|:|:|     .:.| 
 Frog    88 LLGPPGERGDPGIPGMLGPRGEKGDMGPPGPSGPPGERAAKNCME---LLNYGVLFTGWYTIYL- 148

  Fly   289 PESESFYVSCDED-----WTVILSRTSDDVNFERGWLDYRDGFGNLAGDFFIGLNKLHALTSSAL 348
            ..::...|.||.|     |.|...|....|:|.|.|..|:.|||:...:|::|...:|.||||..
 Frog   149 DGNKPIKVLCDMDTDGGGWIVFQRRVDGSVDFYRDWKSYKQGFGSQLSEFWLGNENIHRLTSSGN 213

  Fly   349 HELRIVMEDFSGNVAYAGYSLFAIGSEKELYPLVLLGKFQDNLTPSAGDSLSYHAGAKFSTVDQD 413
            .:||..:|||..|..||.||.|.:..|.:.|.|    :|::.....|||||..|....|||.|.|
 Frog   214 FQLRFDLEDFDNNRTYATYSQFRLEPESQNYTL----RFREFTGGPAGDSLFTHKDRAFSTKDAD 274

  Fly   414 NDNCLECNCALRHKGAGWFNNCAKSNLFGEYTT-QNQPGETGIWWDTFSGQN-SLKRVRWMIRP 475
            ||...:.|||.|:|||.|:.:|..|.|.|||.. |:...:.|:.|..|.|.| |||.....:||
 Frog   275 NDPASKTNCAERYKGAWWYESCYHSCLNGEYMRGQHDKADGGVHWAKFRGVNYSLKVSEMKLRP 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10359NP_001137882.1 FReD 267..476 CDD:238040 80/221 (36%)
col11a2NP_001005799.1 Collagen 45..110 CDD:189968 5/21 (24%)
FReD 128..338 CDD:238040 78/217 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.