DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10359 and tnr

DIOPT Version :9

Sequence 1:NP_001137882.1 Gene:CG10359 / 38434 FlyBaseID:FBgn0035452 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_919364.1 Gene:tnr / 369191 ZFINID:ZDB-GENE-030804-1 Length:1350 Species:Danio rerio


Alignment Length:290 Identity:95/290 - (32%)
Similarity:141/290 - (48%) Gaps:42/290 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   215 LSVRSVQVEVANLSRAIRRQSRLIQGKGLRSTPGQQPIFYGPSGLNG----PTATRQLPSSCSYS 275
            |......:.:..|:.......||...:||.::     :....|...|    ||     |.:|:..
Zfish  1080 LDAEDTWIRLEGLAETTEYTVRLQVARGLETS-----VIVSTSFTTGNRLFPT-----PQNCAQH 1134

  Fly   276 FLSNH---GILKVQLTPE-SESFYVSCD-----EDWTVILSRTSDDVNFERGWLDYRDGFGNLAG 331
            .|:..   ||..:.:..: |:...|.||     ..|.|...|.:...:|.|.|.||:.|||:|..
Zfish  1135 LLNGETLGGIYTIYVNRDLSQGVQVYCDMTTDGGGWIVFQRRQNGLTDFSRKWTDYKIGFGSLED 1199

  Fly   332 DFFIGLNKLHALTSSALHELRIVMEDFSGNVAYAGYSLFAIGSEKELYPLVLLGKFQDNLTPSAG 396
            :|::||:.:|.:.:...:||||.|:|...:| ||.|..|:||..|.||.| .:|::    :.:||
Zfish  1200 EFWLGLDNIHKIAAQGRYELRIDMKDGQESV-YANYDRFSIGDSKSLYKL-RIGEY----SGTAG 1258

  Fly   397 DSLSYHAGAKFSTVDQDNDNCLECNCALRHKGAGWFNNCAKSNLFGEYTTQNQPGET----GIWW 457
            ||||||....|||.|:|||..: .||||.:|||.|:.||.::||.|:|      ||:    ||.|
Zfish  1259 DSLSYHQSRPFSTKDKDNDIAV-TNCALSYKGAWWYKNCHRANLNGKY------GESRHSQGINW 1316

  Fly   458 DTFSGQN-SLKRVRWMIRPIS-EGIDDARR 485
            ..:.|.. |:..|...:||.: ..|...||
Zfish  1317 YHWKGHEFSIPFVEMKMRPFNYRSISGKRR 1346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10359NP_001137882.1 FReD 267..476 CDD:238040 81/222 (36%)
tnrNP_919364.1 EGF_2 199..225 CDD:285248
EB 234..283 CDD:279949
EGF_2 294..318 CDD:285248
fn3 323..401 CDD:278470
fn3 411..490 CDD:278470
fn3 500..579 CDD:278470
FN3 590..674 CDD:238020
fn3 682..754 CDD:278470
fn3 771..849 CDD:278470
FN3 859..935 CDD:214495
fn3 949..1019 CDD:278470
fn3 1035..1103 CDD:278470 3/22 (14%)
FReD 1126..1336 CDD:238040 83/227 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100073
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.