DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10359 and Angptl4

DIOPT Version :9

Sequence 1:NP_001137882.1 Gene:CG10359 / 38434 FlyBaseID:FBgn0035452 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_954546.1 Gene:Angptl4 / 362850 RGDID:735058 Length:405 Species:Rattus norvegicus


Alignment Length:392 Identity:112/392 - (28%)
Similarity:175/392 - (44%) Gaps:94/392 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 EHIQRLSRNTLDEL-------------------KGETDQVFGPRNVRELKHKLR-NRKKMKDISR 174
            ||::| :|..|..|                   |....:...|..::.|:.:|: ...|::.:.:
  Rat    57 EHVER-TRGQLGALERRMAACGNACQGPKGTDPKDRVPEGQAPETLQSLQTQLKAQNSKIQQLFQ 120

  Fly   175 TVRDVSQEQYPSSGIGTFNESNL---NLSSRLDALATLLASTALSVRSVQVEVANLSRAIRRQSR 236
            .|  ..|::|       .::.||   ||.|::|    ||..|            :|...:.:.||
  Rat   121 KV--AQQQRY-------LSKQNLRIQNLQSQID----LLTPT------------HLDNGVDKTSR 160

  Fly   237 LIQGKGLRSTPGQQPIFYGPSGLNGPTATR--QLPSSCSYSFLS---NHGILKVQLTP-ESESFY 295
               ||.|   |....:.    ||. |.|||  :.|..|...|..   :.|:.::|  | .|..|.
  Rat   161 ---GKRL---PKMAQLI----GLT-PNATRLHRPPRDCQELFQEGERHSGLFQIQ--PLGSPPFL 212

  Fly   296 VSC----DEDWTVILSRTSDDVNFERGWLDYRDGFGNLAGDFFIGLNKLHALTSSALHELRIVME 356
            |:|    |..||||..|.:..|:|.:.|..|:||||:..|:|::||.|:|::|.....:|.:.::
  Rat   213 VNCEMTSDGGWTVIQRRLNGSVDFNQSWEAYKDGFGDPQGEFWLGLEKMHSITGDRGSQLAVQLQ 277

  Fly   357 DFSGNVAYAGYSLFAIGSEKELYPLVL-------LGKFQDNLTPSAGDSLSYHAGAKFSTVDQDN 414
            |:.||.....:.:. :|.|...|.|.|       ||  ..|::|: |.||      .|||.|||:
  Rat   278 DWDGNAKLLQFPIH-LGGEDTAYSLQLTEPTANELG--ATNVSPN-GLSL------PFSTWDQDH 332

  Fly   415 DNCLECNCALRHKGAGWFNNCAKSNLFGEY----TTQNQPGETGIWWDTFSGQ-NSLKRVRWMIR 474
            |...:.|||....|..||..|:.|||.|:|    ..|.|..:.||:|.|:.|: ..|:....:|:
  Rat   333 DLRGDLNCAKSLSGGWWFGTCSHSNLNGQYFHSIPRQRQQRKKGIFWKTWKGRYYPLQATTLLIQ 397

  Fly   475 PI 476
            |:
  Rat   398 PM 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10359NP_001137882.1 FReD 267..476 CDD:238040 75/228 (33%)
Angptl4NP_954546.1 FReD 182..399 CDD:238040 75/228 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.