DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10359 and Fga

DIOPT Version :9

Sequence 1:NP_001137882.1 Gene:CG10359 / 38434 FlyBaseID:FBgn0035452 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_001008724.1 Gene:Fga / 361969 RGDID:2603 Length:782 Species:Rattus norvegicus


Alignment Length:392 Identity:112/392 - (28%)
Similarity:162/392 - (41%) Gaps:95/392 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 FLHRLDSFEHIQRLSRNTLDELKGETDQVFG--PRNVRELKHKLRNRKKMKDISRTVRDVSQEQY 184
            |..|||....:.       .||....|..||  ..|.:|...|..:.....||          :.
  Rat   446 FSGRLDELSRMH-------PELGSFYDSRFGSLTSNFKEFGSKTSDSDIFTDI----------EN 493

  Fly   185 PSSGIGTFNESNLNLSSRLDA-----LATLLASTALSVRSVQVEVANLSRAIRRQSRLIQGKGLR 244
            |||.:..|:.|:...:.|...     :|...||.|......:......:|.:|....::|..   
  Rat   494 PSSHVPEFSSSSKTSTVRKQVTKSYKMADEAASEAHQEGDTRTTKRGRARTMRDCDDVLQTH--- 555

  Fly   245 STPGQQPIFYGPSGLNGPTATRQLPSSCSYSFLSNHGILKVQLTPESESFYVSCDED-----WTV 304
                       |||                   :.:||..::|...|:.|.|.||::     |.:
  Rat   556 -----------PSG-------------------AQNGIFSIKLPGSSKIFSVYCDQETSLGGWLL 590

  Fly   305 ILSRTSDDVNFERGWLDYRDGFGNL----AGDFFIGLNKLHALTSSALHELRIVMEDFSGNVAYA 365
            |..|....:||.|.|.||:.|||:|    .|:|::|.:.||.||... ..||:.:||::|..|||
  Rat   591 IQQRMDGSLNFNRTWQDYKRGFGSLNDKGEGEFWLGNDYLHLLTLRG-SVLRVELEDWAGKEAYA 654

  Fly   366 GYSLFAIGSEKELYPLVLLGKFQDNLTPSAGDSL-----------SYHAGAKFSTVDQDNDNCLE 419
            .|. |.:|||.|.|.| .:..:|.    :|||:|           :.|:..:|||.|:|.|...|
  Rat   655 EYH-FRVGSEAEGYAL-QVSSYQG----TAGDALMEGSVEEGTEYTSHSNMQFSTFDRDADQWEE 713

  Fly   420 CNCALRHKGAGWFNNCAKSNLFGEY-------TTQNQPG--ETGIWWDTFSGQN-SLKRVRWMIR 474
             |||..:.|..|:|:|..:||.|.|       ...|.|.  |.|:.|..|.|.: ||:.||..||
  Rat   714 -NCAEVYGGGWWYNSCQAANLNGIYYPGGTYDPRNNSPYEIENGVVWVPFRGADYSLRAVRMKIR 777

  Fly   475 PI 476
            |:
  Rat   778 PL 779

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10359NP_001137882.1 FReD 267..476 CDD:238040 81/238 (34%)
FgaNP_001008724.1 Fib_alpha 51..189 CDD:285864
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 264..374
Fibrinogen_aC 388..453 CDD:288972 4/6 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 522..542 3/19 (16%)
FReD 546..779 CDD:238040 86/273 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.