DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10359 and Tnn

DIOPT Version :9

Sequence 1:NP_001137882.1 Gene:CG10359 / 38434 FlyBaseID:FBgn0035452 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_808507.2 Gene:Tnn / 329278 MGIID:2665790 Length:1560 Species:Mus musculus


Alignment Length:494 Identity:131/494 - (26%)
Similarity:202/494 - (40%) Gaps:134/494 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 TQAPPL--PPRNLRNNQTRSRIPNNFRSIATPPIAPRCD------------YKELMTNLHDRVGI 82
            |:||..  .|:||..|    |:..|..:|:..|:....|            .||:..:......|
Mouse  1141 TKAPTEIDSPKNLVTN----RVTENTATISWDPVRANIDRYMVRYTSADGETKEIPVSKDQSSTI 1201

  Fly    83 LVTLDEDQRHRLEVIDKKLDQLVESSSARMESMKAQQLDFLHRLDSFEHIQRLSRNTLDELKGET 147
            |..|.....:.:.|..:|        .|| ||.||                        :.|..|
Mouse  1202 LTGLKPGMEYTIHVWAQK--------GAR-ESKKA------------------------DTKALT 1233

  Fly   148 DQVFGPRNVRE--LKHKLRNRKKMKDISRTVRDVSQEQYPSSGIGTFNESNLNLSSRLDALATLL 210
             ::..|||:|.  :.|                        |.|:.|:    |..|:::|......
Mouse  1234 -EIDPPRNLRPFGVTH------------------------SGGVLTW----LPPSAQIDGYILTY 1269

  Fly   211 ASTALSVRSVQV-------EVANLSRAIRRQSRLIQGKGLR-----STPGQQPIFYGPSGLNGPT 263
            .....:|:.|::       |:.:|.:.:.....|:..||.:     ||.           |:...
Mouse  1270 QFPNGTVKEVELPRGQQRFELQDLEQGVTYPVSLVAFKGNQRSRTVSTT-----------LSTVD 1323

  Fly   264 ATRQLPSSCSYSFLSNH---GILKVQLTPE-SESFYVSCDED-----WTVILSRTSDDVNFERGW 319
            |....||.||....:.:   |:..:.|..: |....|.||.|     |.|...|.:..::|.:.|
Mouse  1324 ARFPHPSDCSQVQQNTNAASGLYTIYLNGDASRPMQVYCDMDTDGGGWIVFQRRNTGQLDFFKRW 1388

  Fly   320 LDYRDGFGNLAGDFFIGLNKLHALT--SSALHELRIVMEDFSGNVAYAGYSLFAIGSEKELYPLV 382
            ..|.:|||:...:|::||:|||.||  ::..:|:|..::.|:.: |||.|..|.:.|.||.|.| 
Mouse  1389 RSYVEGFGDPMKEFWLGLDKLHNLTTGTTTRYEVRADLQTFNES-AYAVYDFFQVASSKERYKL- 1451

  Fly   383 LLGKFQDNLTPSAGDSLSYHAGAKFSTVDQDNDNCLECNCALRHKGAGWFNNCAKSNLFGEYTTQ 447
            .:||::.    :|||:|:||.|.||:|.|:|||..|. ||||.|.|..|:.||..:|..|:|   
Mouse  1452 SVGKYRG----TAGDALTYHNGWKFTTFDRDNDIALS-NCALTHHGGWWYKNCHLANPNGKY--- 1508

  Fly   448 NQPGET----GIWWDTFSGQN-SLKRVRWMIRPISEGID 481
               |||    |:.|:.:.|.. |:..|...|||.....|
Mouse  1509 ---GETKHSEGVNWEPWKGHEFSIPYVELKIRPFGYSRD 1544

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10359NP_001137882.1 FReD 267..476 CDD:238040 80/224 (36%)
TnnNP_808507.2 EGF_2 <142..166 CDD:285248
EGF_2 169..197 CDD:285248
EB 181..233 CDD:279949
EGF_2 233..259 CDD:285248
fn3 264..332 CDD:278470
fn3 359..434 CDD:278470
fn3 444..521 CDD:278470
FN3 532..608 CDD:214495
FN3 620..696 CDD:214495
fn3 708..785 CDD:278470
fn3 796..875 CDD:278470
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 868..888
fn3 884..961 CDD:278470
fn3 972..1049 CDD:278470
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1044..1063
FN3 1060..1136 CDD:214495
fn3 1148..1225 CDD:278470 19/89 (21%)
fn3 1236..1313 CDD:278470 18/104 (17%)
FReD 1327..1539 CDD:238040 80/224 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100073
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.