DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10359 and CG31832

DIOPT Version :9

Sequence 1:NP_001137882.1 Gene:CG10359 / 38434 FlyBaseID:FBgn0035452 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_723894.2 Gene:CG31832 / 318970 FlyBaseID:FBgn0051832 Length:227 Species:Drosophila melanogaster


Alignment Length:212 Identity:89/212 - (41%)
Similarity:118/212 - (55%) Gaps:14/212 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   269 PSSCSYSFLSNHGILKVQLTPESESFYVS-CD---EDWTVILSRTSDDVNFERGWLDYRDGFGNL 329
            |.:|...  |.:||.::.| ||.|.|.|: |.   .||.||..|....|||.:.|..|:||||:.
  Fly    22 PHTCPSG--SPNGIHQLML-PEEEPFQVTQCKTTARDWIVIQRRLDGSVNFNQSWFSYKDGFGDP 83

  Fly   330 AGDFFIGLNKLHALTSSALHELRIVMEDFSGNVAYAGYSLFAIGSEKELYPLVLLGKFQDNLTPS 394
            .|:|||||.||:.:|....|||.|.::...|...||.:..|.:.||.|||.|..:||:    :.:
  Fly    84 NGEFFIGLQKLYLMTREQPHELFIQLKHGPGATVYAHFDDFQVDSETELYKLERVGKY----SGT 144

  Fly   395 AGDSLSYHAGAKFSTVDQDNDNCLECNCALRHKGAGWFNNCAKSNLFGEYTTQNQPGE-TGIWWD 458
            |||||.||...:|||.|:|||...: |||..|.|..||::|..|:|.|.|..:.:.|. .||.|.
  Fly   145 AGDSLRYHINKRFSTFDRDNDESSK-NCAAEHGGGWWFHSCLSSSLNGLYFREGETGMLNGIHWG 208

  Fly   459 TFSGQNSLKRVRWMIRP 475
            .:..| ||..|:.||||
  Fly   209 RWKFQ-SLTFVQIMIRP 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10359NP_001137882.1 FReD 267..476 CDD:238040 89/212 (42%)
CG31832NP_723894.2 FReD 28..225 CDD:238040 87/206 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446513
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D84222at33392
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 1 1.000 - - otm14151
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
87.850

Return to query results.
Submit another query.